Germany
Japan
United Kingdom
China
VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VEGFC (GFP-tagged) - Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
VEGFC (untagged)-Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Vegfc (GFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VEGFC - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409451 is the updated version of KN209451.
Vegfc - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518879 is the updated version of KN318879.
Lenti ORF clone of Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vegfc (Myc-DDK-tagged) - Mouse vascular endothelial growth factor C (Vegfc), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vegfc (mGFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vegfc (GFP-tagged) - Mouse vascular endothelial growth factor C (Vegfc), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Vegfc (Myc-DDK-tagged ORF) - Rat vascular endothelial growth factor C (Vegfc), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Vegfc (Myc-DDK-tagged ORF) - Rat vascular endothelial growth factor C (Vegfc), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vegfc (Myc-DDK-tagged ORF) - Rat vascular endothelial growth factor C (Vegfc), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vegfc (mGFP-tagged ORF) - Rat vascular endothelial growth factor C (Vegfc), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vegfc (GFP-tagged ORF) - Rat vascular endothelial growth factor C (Vegfc), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC).
| Tag | C-His |
| Expression Host | HEK293 |
Vegfc (untagged) - Mouse vascular endothelial growth factor C (Vegfc), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | CHO |
VEGF-C / Flt4-L human recombinant protein, 20 µg
| Expression Host | Insect |
VEGF-C / Flt4-L human recombinant protein, 5 µg
| Expression Host | Insect |
VEGF-C / Flt4-L rat recombinant protein, 5 µg
| Expression Host | Insect |
VEGF-C / Flt4-L rat recombinant protein, 20 µg
| Expression Host | Insect |
VEGF-C / Flt4-L (VEGF-C152S) rat recombinant protein, 5 µg
| Expression Host | Insect |
VEGF-C / Flt4-L (VEGF-C152S) rat recombinant protein, 20 µg
| Expression Host | Insect |
Rabbit polyclonal anti-VEGF-C antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant murine VEGF-C |
VEGFC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1). |
| Modifications | Unmodified |
VEGFC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1). |
| Modifications | Unmodified |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
VEGFC - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
VEGFC - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
VEGFC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Vegfc (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
qPCR primer pairs and template standards against Homo sapiens gene VEGFC
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Vegfc
Rabbit Polyclonal Anti-VEGFC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 0.25 mg
| Tag | His-tag |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 50 µg
| Tag | His-tag |
Active filters
Target Symbol
- VEGFC