Germany
Japan
United Kingdom
China
WBP2NL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WBP2NL. |
Products
View as table Download
WBP2NL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WBP2NL. |
Rabbit Polyclonal Anti-WBP2NL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP2NL antibody: synthetic peptide directed towards the N terminal of human WBP2NL. Synthetic peptide located within the following region: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
Rabbit Polyclonal Anti-WBP2NL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP2NL antibody: synthetic peptide directed towards the middle region of human WBP2NL. Synthetic peptide located within the following region: GYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLP |
Active filters
Target Symbol
- WBP2NL
Clonalities
- Polyclonal