WBP2NL (Myc-DDK-tagged)-Human WBP2 N-terminal like (WBP2NL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WBP2NL (Myc-DDK-tagged)-Human WBP2 N-terminal like (WBP2NL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human WBP2 N-terminal like (WBP2NL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Wbp2nl (Myc-DDK-tagged) - Mouse WBP2 N-terminal like (Wbp2nl)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WBP2NL (GFP-tagged) - Human WBP2 N-terminal like (WBP2NL)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WBP2NL - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Wbp2nl - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Wbp2nl (GFP-tagged) - Mouse WBP2 N-terminal like (Wbp2nl), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Wbp2nl (Myc-DDK-tagged) - Mouse WBP2 N-terminal like (Wbp2nl)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wbp2nl (Myc-DDK-tagged) - Mouse WBP2 N-terminal like (Wbp2nl), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wbp2nl (mGFP-tagged) - Mouse WBP2 N-terminal like (Wbp2nl)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wbp2nl (GFP-tagged) - Mouse WBP2 N-terminal like (Wbp2nl), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human WBP2 N-terminal like (WBP2NL), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WBP2NL (Myc-DDK tagged) - Human WBP2 N-terminal like (WBP2NL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human WBP2 N-terminal like (WBP2NL), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WBP2NL (mGFP-tagged) - Human WBP2 N-terminal like (WBP2NL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WBP2NL Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WBP2NL. |
WBP2NL Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WBP2NL. |
Transient overexpression lysate of WBP2 N-terminal like (WBP2NL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-WBP2NL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WBP2NL antibody: synthetic peptide directed towards the N terminal of human WBP2NL. Synthetic peptide located within the following region: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
Rabbit Polyclonal Anti-WBP2NL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WBP2NL antibody: synthetic peptide directed towards the middle region of human WBP2NL. Synthetic peptide located within the following region: GYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLP |
WBP2NL CRISPRa kit - CRISPR gene activation of human WBP2 N-terminal like
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene WBP2NL
WBP2NL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Wbp2nl (untagged) - Mouse WBP2 N-terminal like (Wbp2nl), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Wbp2nl
WBP2NL MS Standard C13 and N15-labeled recombinant protein (NP_689826)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
WBP2NL (untagged)-Human WBP2 N-terminal like (WBP2NL)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
WBP2NL (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Wbp2nl (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of WBP2NL (NM_152613) in HEK293T cells paraffin embedded controls for ICC/IHC staining
WBP2NL - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
WBP2NL - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Wbp2nl - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Wbp2nl - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse WBP2 N-terminal like (Wbp2nl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Tag | C-MYC/DDK |
Expression Host | HEK293T |
WBP2NL - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Wbp2nl - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of WBP2NL (NM_152613) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WBP2NL (NM_152613) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack