Products

View as table Download

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP10

Rabbit polyclonal DUSP10 antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10.

Goat Polyclonal Antibody against DUSP10 / MKP5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRILTPKLMGVETVV, from the C Terminus of the protein sequence according to NP_009138.1; NP_653329.1; NP_653330.1.

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE

Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated