Products

View as table Download

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

Rabbit Polyclonal Anti-TGFR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.

Rabbit anti-TGFBR2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TGFBR2

Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1
Modifications Phospho-specific

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

Rabbit Polyclonal antibody to BCL-x (BCL2-like 1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 208 of Bcl-X (Uniprot ID#Q07817)

Rabbit polyclonal TGF Beta Receptor I (Ab-165) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGF β Receptor I around the phosphorylation site of serine 165 (D-P-SP-L-D).

Rabbit polyclonal anti-TGF beta2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β2.

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.

Rabbit polyclonal anti-ACTR-1C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACTR-1C.

Rabbit polyclonal anti-ACVR1C (ALK7) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 155 of mouse ALK-7

Rabbit anti-ACVR1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACVR1B

Rabbit anti TGFBR1(pS165) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TGFbR1 surrounding the Serine 165

Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I).
Modifications Phospho-specific

Anti-BCL2L1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 1-210 amino acids of Human Bcl-2-like protein 1

Rabbit Polyclonal BCL-XL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-XL

Rabbit Polyclonal BCL-XL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-XL

Rabbit Polyclonal BCL-XL (Ser62) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Serine 62
Modifications Phospho-specific

Rabbit Polyclonal BCL-XL (Thr47) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Threonine 47
Modifications Phospho-specific

Rabbit Polyclonal Anti-ACVR1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP

Rabbit anti TGF beta R1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal epitope (180aa-210aa) of human TGFbR1 protein

Rabbit polyclonal anti-ACV1B antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACV1B.

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 366 of human TGF-β2

BCL2L1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCL2L1

Rabbit anti TGFBR1(Phospho) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bcl-xL antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human Bcl-xL.

Rabbit polyclonal anti-BCL-XL antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human BCL-XL.

Rabbit polyclonal BCL-XL (Thr115) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BCL-XL around the phosphorylation site of threonine 115 (H-I-TP-P-G).
Modifications Phospho-specific

Rabbit polyclonal TGF beta Receptor II antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody.

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human TGF-β2

Rabbit polyclonal anti-TGF-beta Receptor II antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 555 of rat TGF-β Receptor II.

Rabbit Polyclonal Anti-TGFBR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Canine, Feline, Human, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817]

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine, Feline, Hamster, Porcin
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817]

Rabbit anti Bcl-X Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of human BCL-X protein. This sequence is identical in human and mouse.

Rabbit anti TGF-beta 2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein.

Rabbit anti TGF beta Receptor II Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of human TGFbR2

Rabbit anti BCL-XL(pS62) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti TGFBR1(Non-Phosphospecific) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti RWSP18 Polyclonal Antibody

Reactivities Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Bcl-XL mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BCL2L1 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGFBR2 mouse monoclonal antibody, clone OTI4F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACVR1B rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 218-381 amino acids of human activin A receptor, type IB

Anti-ACVR1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 218-381 amino acids of human activin A receptor, type IB

Anti-BCL2L1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-210 amino acids of human BCL2-like 1

Anti-ACVR1C Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-485 amino acids of human activin A receptor, type IC