Products

Jump to Filters
View as table Download
AE2 (SLC4A2) Rabbit Polyclonal Antibody
TA317336

USD 425.00

5 Days

SLC4A2 / AE2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC4A2 / AE2 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Rabbit, Pig (100%); Monkey, Bovine, Guinea pig (94%); Elephant (89%); Bat, Opossum (83%).
SLC7A2 Rabbit Polyclonal Antibody
TA317347

USD 425.00

5 Days

SLC7A2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen SLC7A2 antibody was raised against synthetic 12 amino acid peptide from internal region of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Rabbit, Pig (100%); Orangutan, Gibbon, Galago, Marmoset, Hamster, Bovine, Bat, Horse (92%); Panda, Dog, Platypus (83%).
TAS1R1 Rabbit Polyclonal Antibody
TA317408

USD 425.00

5 Days

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit
TM9SF4 Rabbit Polyclonal Antibody
TA317430

USD 425.00

5 Days

TM9SF4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen TM9SF4 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Panda (87%); Opossum (80%).
TNIK Rabbit Polyclonal Antibody
TA317446

USD 425.00

5 Days

TNIK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen TNIK antibody was raised against synthetic 18 amino acid peptide from internal region of human TNIK. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Lizard (100%); Xenopus (94%).
TRPV4 Rabbit Polyclonal Antibody
TA317467

USD 425.00

5 Days

TRPV4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%).
Tspan 13 (TSPAN13) Rabbit Polyclonal Antibody
TA317469

USD 425.00

5 Days

TSPAN13 / TM4SF13 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen TSPAN13 / TM4SF13 antibody was raised against synthetic 13 amino acid peptide from internal region of human TSPAN13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Elephant, Panda, Horse, Rabbit (100%); Bat, Bovine, Hamster, Opossum, Platypus (92%).
Tspan 13 (TSPAN13) Rabbit Polyclonal Antibody
TA317470

USD 425.00

5 Days

TSPAN13 / TM4SF13 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen TSPAN13 / TM4SF13 antibody was raised against synthetic 13 amino acid peptide from internal region of human TSPAN13. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Horse (100%); Orangutan, Elephant, Panda, Dog, Rabbit, Opossum, Platypus (92%); Bat, Bovine, Pig, Guinea pig, Pufferfish, Zebrafish (85%).
USP2 Rabbit Polyclonal Antibody
TA317489

USD 425.00

5 Days

USP2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen USP2 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum (100%); Pig (94%).
WNT6 Rabbit Polyclonal Antibody
TA317519

USD 425.00

5 Days

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).
WNT8A Rabbit Polyclonal Antibody
TA317524

USD 425.00

5 Days

WNT8A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey
Conjugation Unconjugated
Immunogen WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%).
WNT8B Rabbit Polyclonal Antibody
TA317525

USD 425.00

5 Days

WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%).
Vasopressin V1b receptor (AVPR1B) Rabbit Polyclonal Antibody
TA317556

USD 425.00

5 Days

AVPR1B Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%).
HRH3 Rabbit Polyclonal Antibody
TA317598

USD 425.00

5 Days

Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Guinea pig (100%); Panda, Bat, Dog (94%); Opossum (81%).
Metabotropic Glutamate Receptor 2 (GRM2) Rabbit Polyclonal Antibody
TA317616

USD 425.00

5 Days

MGLUR2 / GLUR2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen GRM2 / MGLUR2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM2 / MGLUR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Pig (100%); Chimpanzee, Monkey, Horse, Platypus (95%).
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA317617

USD 425.00

5 Days

GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%).
Angiotensin II Type 2 Receptor (AGTR2) Rabbit Polyclonal Antibody
TA317626

USD 425.00

5 Days

AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%).
Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody
TA317661

USD 425.00

5 Days

Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%).
WNT9B Rabbit Polyclonal Antibody
TA317687

USD 425.00

5 Days

WNT9B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen WNT9B / WNT15 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT9B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig (100%); Bat, Rabbit (94%); Dog (88%).
PLA2G3 Rabbit Polyclonal Antibody
TA317693

USD 425.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).
GIRK2 (KCNJ6) Rabbit Polyclonal Antibody
TA317916

USD 425.00

5 Days

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%).
ADAMTS1 Rabbit Polyclonal Antibody
TA317920

USD 425.00

5 Days

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 17 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Horse (94%); Bat, Pig (88%); Mouse, Rat, Hamster, Rabbit (82%).
WNT11 Rabbit Polyclonal Antibody
TA317956

USD 425.00

5 Days

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).
WNT4 Rabbit Polyclonal Antibody
TA317957

USD 425.00

5 Days

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%).
WNT4 Rabbit Polyclonal Antibody
TA317958

USD 425.00

5 Days

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%).
GIRK2 (KCNJ6) Rabbit Polyclonal Antibody
TA318841

USD 425.00

5 Days

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%).
ENTPD2 Rabbit Polyclonal Antibody
TA318852

USD 425.00

5 Days

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Human, Monkey
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 14 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey (100%); Gorilla, Bovine, Horse (93%); Galago, Elephant, Guinea pig (86%).
Oct4 (POU5F1) Rabbit Polyclonal Antibody
TA319164

USD 530.00

5 Days

Rabbit polyclonal anti-Oct-4 antibody

Applications WB
Reactivities Human, Monkey, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein.
NEDD4 Rabbit Polyclonal Antibody
TA319441

USD 530.00

5 Days

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.
TRIM29 Rabbit Polyclonal Antibody
TA319472

USD 530.00

5 Days

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.
TRIM29 Rabbit Polyclonal Antibody
TA319473

USD 530.00

5 Days

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.
GRP94 (HSP90B1) Rat Monoclonal Antibody [Clone ID: 9G10]
TA326419

USD 375.00

5 Days

Mouse monoclonal GRP94 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig, Horse
Conjugation Unconjugated
SIAH3 Rabbit Polyclonal Antibody
TA334840

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIAH3 Antibody

Applications WB
Reactivities Human, Rabbit, Dog, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA
GPR116 (ADGRF5) Rabbit Polyclonal Antibody
TA340430

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPR116 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR116 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR116. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Hamster, Elephant, Panda, Horse, Rabbit, Pig (94%); Platypus (88%); Bovine, Bat, Ant (81%).
MCH2 (MCHR2) Rabbit Polyclonal Antibody
TA340435

USD 425.00

5 Days

Rabbit Polyclonal Anti-MCHR2 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MCHR2 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human MCHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Panda, Horse, Platypus (94%); Bat, Elephant, Pig, Xenopus (88%); Bovine (81%).
Steroidogenic Factor 1 (NR5A1) Rabbit Polyclonal Antibody
TA340512

USD 425.00

5 Days

Rabbit Polyclonal Anti-NR5A1 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse, Rat, Hamster, Elephant, Dog, Horse, Pig (94%); Monkey, Sheep, Panda, Bovine, Rabbit (88%); Opossum, Platypus (81%).
Steroidogenic Factor 1 (NR5A1) Rabbit Polyclonal Antibody
TA340516

USD 425.00

5 Days

Rabbit Polyclonal Anti-NR5A1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig (94%); Mouse, Rat, Hamster (88%); Turkey, Chicken, Platypus, Xenopus (82%).
CCR9 Rabbit Polyclonal Antibody
TA340544

USD 425.00

5 Days

Rabbit Polyclonal Anti-CCR9 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CCR9 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CCR9. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Sheep, Bovine, Bat, Pig (100%); Monkey, Ferret, Panda, Dog, Horse, Opossum (94%); Elephant (88%).
GNRHR Rabbit Polyclonal Antibody
TA340636

USD 425.00

5 Days

Rabbit Polyclonal Anti-GNRHR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GnRH receptor / GNRHR antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human GNRHR. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Dog, Elephant, Panda (95%); Marmoset, Bovine, Horse, Pig (90%); Mouse, Rat, Sheep, Bat, Rabbit, Opossum (85%); Hamster, Guinea pig (80%).
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA340759

USD 425.00

5 Days

Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%).
BAI2 (ADGRB2) Rabbit Polyclonal Antibody
TA340765

USD 425.00

5 Days

Rabbit Polyclonal Anti-BAI2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen BAI2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human BAI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Orangutan, Monkey, Horse (95%); Hamster, Elephant, Panda, Pig (89%); Gibbon, Mouse, Rat, Dog (84%).
Flamingo homolog 1 (CELSR3) Rabbit Polyclonal Antibody
TA340844

USD 425.00

5 Days

Rabbit Polyclonal Anti-CELSR3 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CELSR3 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CELSR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Bovine, Panda (100%); Monkey, Mouse, Rat, Bat, Hamster, Elephant, Horse (95%); Rabbit (90%).
GPRC5B Rabbit Polyclonal Antibody
TA340928

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPRC5B Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RAIG2 / GPRC5B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPRC5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bovine, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Xenopus, Pufferfish, Zebrafish, Stickleback (94%).
MC3R Rabbit Polyclonal Antibody
TA340939

USD 425.00

5 Days

Rabbit Polyclonal Anti-MC3R Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MC3R / MC3 Receptor antibody was raised against synthetic 18 amino acid peptide from C-Terminus of human MC3 Receptor. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (94%); Bat, Rabbit, Platypus (89%); Opossum, Turkey, Chicken, Xenopus, Trout (83%).
TAOK1 Rabbit Polyclonal Antibody
TA341014

USD 425.00

5 Days

Rabbit Polyclonal Anti-TAOK1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TAOK1 / TAO1 antibody was raised against synthetic 15 amino acid peptide from internal region of human TAOK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus (93%).
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA341022

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Horse, Rabbit, Guinea pig, Platypus (94%); Dog, Bat (88%); Rat, Panda (81%).
NUR77 (NR4A1) Rabbit Polyclonal Antibody
TA341067

USD 425.00

5 Days

Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%).
CERK Rabbit Polyclonal Antibody
TA341119

USD 425.00

5 Days

Rabbit Polyclonal Anti-CERK Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%).
WNT5B Rabbit Polyclonal Antibody
TA341121

USD 425.00

5 Days

Rabbit Polyclonal Anti-WNT5B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT5B antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset (100%); Gorilla, Elephant, Panda, Dog, Horse, Rabbit, Pig, Opossum (93%); Mouse, Hamster, Bovine (86%).
MCK10 (DDR1) Rabbit Polyclonal Antibody
TA341122

USD 425.00

5 Days

Rabbit Polyclonal Anti-DDR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NEP / DDR1 antibody was raised against synthetic 16 amino acid peptide from internal region of human DDR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Pig (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse (94%); Opossum (88%); Rabbit (81%).