Products

View as table Download

Mouse Anti-Human IFN gamma Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Mouse Anti-Human IFN gamma Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2. Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL

Mouse anti IFN gamma Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNGR2

IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated