Products

Jump to Filters
View as table Download
GAPDH Mouse Monoclonal Antibody [Clone ID: H8]
AM09140PU-N

USD 375.00

2 Weeks

GAPDH mouse monoclonal antibody, clone H8, Purified

Applications ELISA, WB
Reactivities Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast
Conjugation Unconjugated
GAPDH Mouse Monoclonal Antibody [Clone ID: H8]
AM09140PU-L

USD 590.00

2 Weeks

GAPDH mouse monoclonal antibody, clone H8, Purified

Applications ELISA, WB
Reactivities Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast
Conjugation Unconjugated
HSP90AB1 Mouse Monoclonal Antibody [Clone ID: AC-16]
TA326371

USD 430.00

5 Days

Mouse monoclonal Hsp90 Antibody

Applications IHC
Reactivities Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line
Conjugation Unconjugated
GABARAP Rabbit Polyclonal Antibody
TA339169

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Manducasexta
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
PCNA Mouse Monoclonal Antibody [Clone ID: PC10]
TA353373L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-PCNA Clone PC10

Reactivities Human, Insect, Saccharomyces pombe
Conjugation Unconjugated