Products

View as table Download

Rabbit polyclonal antibody to APBB3 (amyloid beta (A4) precursor protein-binding, family B, member 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 242 and 486 of APBB3 (Uniprot ID#O95704)

Rabbit polyclonal APBB3 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APBB3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the Central region of human APBB3.

Rabbit Polyclonal Anti-APBB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APBB3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human APBB3

APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated