Products

View as table Download

APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Apbb3 (Myc-DDK-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

APBB3 (GFP-tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

APBB3 (GFP-tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

APBB3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402016 is the updated version of KN202016.

Apbb3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501386 is the updated version of KN301386.

Apbb3 (GFP-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Apbb3 (Myc-DDK-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Apbb3 (Myc-DDK-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Apbb3 (mGFP-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Apbb3 (GFP-tagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (mGFP-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (Myc-DDK tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, APBB3 (mGFP-tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

APBB3 (GFP-tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

APBB3 (GFP-tagged) - Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Apbb3 (Myc-DDK-tagged ORF) - Rat amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Apbb3 (Myc-DDK-tagged ORF) - Rat amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Apbb3 (Myc-DDK-tagged ORF) - Rat amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Apbb3 (mGFP-tagged ORF) - Rat amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Apbb3 (GFP-tagged ORF) - Rat amyloid beta (A4) precursor protein-binding, family B, member 3 (Apbb3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

APBB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Apbb3 (untagged) - Mouse amyloid beta (A4) precursor protein-binding, family B, member 3 (cDNA clone MGC:38710 IMAGE:5357681), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

APBB3 (untagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

APBB3 (untagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

APBB3 (untagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 3 (APBB3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal antibody to APBB3 (amyloid beta (A4) precursor protein-binding, family B, member 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 242 and 486 of APBB3 (Uniprot ID#O95704)

Rabbit polyclonal APBB3 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APBB3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the Central region of human APBB3.

Rabbit Polyclonal Anti-APBB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APBB3 CRISPRa kit - CRISPR gene activation of human amyloid beta precursor protein binding family B member 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Apbb3 CRISPRa kit - CRISPR gene activation of mouse amyloid beta (A4) precursor protein-binding, family B, member 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene APBB3

Application Plasmid of exact quantity for transcript copy number calculation