Products

View as table Download

Rabbit Polyclonal Anti-GPR176 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

GPR176 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR176