Germany
Japan
United Kingdom
China
Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
GPR176 (GFP-tagged) - Human G protein-coupled receptor 176 (GPR176)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR176 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN420955 is the updated version of KN220955.
Gpr176 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507224 is the updated version of KN307224.
Lenti ORF clone of Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gpr176 (mGFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gpr176 (myc-DDK-tagged) - Rat G protein-coupled receptor 176 (Gpr176)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR176 (untagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Gpr176 (untagged) - Mouse G protein-coupled receptor 176 (Gpr176), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene GPR176
qSTAR qPCR primer pairs against Mus musculus gene Gpr176
Rabbit Polyclonal Anti-GPR176 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST |
GPR176 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
GPR176 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor 176
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gpr176 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor 176
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GPR176
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Gpr176
| Application | Plasmid of exact quantity for transcript copy number calculation |
Gpr176 (untagged) - Rat G protein-coupled receptor 176 (Gpr176)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of G protein-coupled receptor 176 (GPR176) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
GPR176 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR323390 is the updated version of SR307714.
Gpr176 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GPR176 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR176 |
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GPR176 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Gpr176 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Gpr176 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
GPR176 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Gpr176 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPR176