Products

View as table Download

Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GPR176 (GFP-tagged) - Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GPR176 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN420955 is the updated version of KN220955.

Gpr176 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507224 is the updated version of KN307224.

Lenti ORF clone of Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gpr176 (mGFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gpr176 (myc-DDK-tagged) - Rat G protein-coupled receptor 176 (Gpr176)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (untagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Gpr176 (untagged) - Mouse G protein-coupled receptor 176 (Gpr176), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

qSTAR qPCR primer pairs against Homo sapiens gene GPR176

qSTAR qPCR primer pairs against Mus musculus gene Gpr176

Rabbit Polyclonal Anti-GPR176 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

GPR176 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

GPR176 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor 176

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Gpr176 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor 176

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene GPR176

Application Plasmid of exact quantity for transcript copy number calculation

qPCR primer pairs and template standards against Mus musculus gene Gpr176

Application Plasmid of exact quantity for transcript copy number calculation

Gpr176 (untagged) - Rat G protein-coupled receptor 176 (Gpr176)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of G protein-coupled receptor 176 (GPR176) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6 series
Tag Tag Free

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6 series
Tag Tag Free

GPR176 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR323390 is the updated version of SR307714.

Gpr176 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

GPR176 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR176

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR176 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin

Gpr176 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Gpr176 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

GPR176 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Gpr176 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

USD 225.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack