Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPR176 (GFP-tagged) - Human G protein-coupled receptor 176 (GPR176)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPR176 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Gpr176 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gpr176 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 176 (Gpr176), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Gpr176 (mGFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gpr176 (GFP-tagged) - Mouse G protein-coupled receptor 176 (Gpr176), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gpr176 (myc-DDK-tagged) - Rat G protein-coupled receptor 176 (Gpr176)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPR176 (untagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Gpr176 (untagged) - Mouse G protein-coupled receptor 176 (Gpr176), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene GPR176
qSTAR qPCR primer pairs against Mus musculus gene Gpr176
Rabbit Polyclonal Anti-GPR176 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST |
GPR176 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
GPR176 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor 176
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gpr176 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor 176
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GPR176
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Gpr176
Application | Plasmid of exact quantity for transcript copy number calculation |
Gpr176 (untagged) - Rat G protein-coupled receptor 176 (Gpr176)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of G protein-coupled receptor 176 (GPR176) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
GPR176 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Gpr176 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GPR176 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR176 |
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GPR176 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol (34 ug/ml) |
Mammalian Cell Selection | Puromycin |
Gpr176 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Gpr176 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
GPR176 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Gpr176 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack