ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ICOSLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ICOSLG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ICOSLG |
ICOSL Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1). |
Modifications | Unmodified |
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |