Germany
Japan
United Kingdom
China
ICOSLG (Myc-DDK-tagged)-Human inducible T-cell co-stimulator ligand (ICOSLG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ICOSLG (GFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
2 Weeks
Lenti ORF particles, ICOSLG (Myc-DDK tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, ICOSLG (mGFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ICOSLG - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408975 is the updated version of KN208975.
Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, ICOSLG (Myc-DDK tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, ICOSLG (mGFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ICOSLG (myc-DDK-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICOSLG (myc-DDK-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICOSLG (myc-DDK-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human inducible T-cell co-stimulator ligand (ICOSLG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ICOSLG - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ICOSLG (untagged)-Human inducible T-cell co-stimulator ligand (ICOSLG)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression lysate of inducible T-cell co-stimulator ligand (ICOSLG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Mouse Monoclonal Anti-ICOSLG Antibody, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
ICOSLG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG), with C-terminal DDK/His tag, expressed in human cells, 20 µg
| Tag | C-DDK/His |
| Expression Host | HEK293 |
LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ICOSLG CRISPRa kit - CRISPR gene activation of human inducible T cell costimulator ligand
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ICOSLG
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ICOSLG
ICOSLG MS Standard C13 and N15-labeled recombinant protein (NP_056074)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ICOSLG (GFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICOSLG (GFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICOSLG (GFP-tagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ICOSLG (untagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ICOSLG (untagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ICOSLG (untagged) - Human inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-ICOSLG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ICOSLG |
ICOSL Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Active filters
Target Symbol
- ICOSLG