Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 Antibody: A synthesized peptide derived from human MCM5 |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Mouse monoclonal Anti-MCM5 Clone A2.5A12.A12.A11
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A4.8D6.H10.D9
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone 6G8A4F10
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2.2C9.C9.C11
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 12A7
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 4B4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 9B4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 2C11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 10A12
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti MCM5 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
MCM5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MCM5 |
MCM5 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MCM5 |
MCM5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MCM5 |
MCM5 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human MCM5 (NP_006730.2). |
| Modifications | Unmodified |
MCM5 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human MCM5 |
MCM5 Rabbit monoclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MCM5
Conjugates
- Unconjugated