Products

View as table Download

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Goat Polyclonal Antibody against PPP2R5D

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236.

Rabbit polyclonal anti-PPP2R5D antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D.

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PP2A-B56δ/PR61δ/PPP2R5D Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D (NP_006236.1).
Modifications Unmodified

PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated