PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Ppp2r5d (Myc-DDK-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5D - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Ppp2r5d - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Ppp2r5d (GFP-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Ppp2r5d (Myc-DDK-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Ppp2r5d (Myc-DDK-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Ppp2r5d (mGFP-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Ppp2r5d (GFP-tagged) - Mouse protein phosphatase 2, regulatory subunit B (B56), delta isoform (Ppp2r5d), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP2R5D (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PPP2R5D (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP2R5D (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP2R5D (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA |
Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP2R5D rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta |
Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against PPP2R5D
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236. |
Rabbit polyclonal anti-PPP2R5D antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D. |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |