PPP2R5D (NM_006245) Human Recombinant Protein
CAT#: TP301945
Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201945 protein sequence
Red=Cloning site Green=Tags(s) MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS KIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLK FKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHL QLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQI NHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKA EKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLK DIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006236 |
Locus ID | 5528 |
UniProt ID | Q14738, A0A024RD11 |
Cytogenetics | 6p21.1 |
Refseq Size | 3065 |
Refseq ORF | 1806 |
Synonyms | B56D; B56delta; MRD35 |
Summary | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Phosphatase |
Protein Pathways | Oocyte meiosis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405833 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405834 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC416775 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430509 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405833 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 396.00 |
|
LY405834 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 3 |
USD 605.00 |
|
LY416775 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1 |
USD 396.00 |
|
LY430509 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 396.00 |
|
PH300647 | PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_851307) |
USD 2,055.00 |
|
PH301945 | PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_006236) |
USD 2,055.00 |
|
TP300647 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 867.00 |
|
TP760026 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review