PPP2R5D (NM_180976) Human Mass Spec Standard
CAT#: PH300647
PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_851307)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200647 |
| Predicted MW | 66.2 kDa |
| Protein Sequence |
>RC200647 protein sequence
Red=Cloning site Green=Tags(s) MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS KIKYSGGPQIVKKELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAV TMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLA LLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFA LPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSPKEVMFLN ELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYR NSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMF RAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAE EFLTASQEAL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_851307 |
| RefSeq Size | 2969 |
| RefSeq ORF | 1710 |
| Synonyms | B56D; B56delta; MRD35 |
| Locus ID | 5528 |
| UniProt ID | Q14738 |
| Cytogenetics | 6p21.1 |
| Summary | 'The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]' |
| Protein Families | Phosphatase |
| Protein Pathways | Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405833 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC405834 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC416775 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430509 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY405833 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 436.00 |
|
| LY405834 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 3 |
USD 665.00 |
|
| LY416775 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1 |
USD 436.00 |
|
| LY430509 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 396.00 |
|
| PH301945 | PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_006236) |
USD 2,055.00 |
|
| TP300647 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
USD 867.00 |
|
| TP301945 | Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1 |
USD 823.00 |
|
| TP760026 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China