Products

View as table Download

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: RELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNN

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG

Rabbit polyclonal RNH1 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RNH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 425-454 amino acids from the C-terminal region of human RNH1.

Rabbit Polyclonal Anti-RNH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-RNH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RNH1

RNH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RNH1

RNH1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-461 of human RNH1 (NP_002930.2).
Modifications Unmodified

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

RNH1 (Ribonuclease Inhibitor) mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated