Products

Jump to Filters
View as table Download
SMPD4 Rabbit Polyclonal Antibody
TA342050

USD 375.00

5 Days

Rabbit Polyclonal Anti-Smpd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP
SMPD4 Rabbit Polyclonal Antibody
TA381796

USD 220.00

3 Weeks

SMPD4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-800 of human SMPD4 (NP_060421.2).
Modifications Unmodified