Products

cDNA Clones (56)
Proteins (9)
Gene Expression (8)
RNAi (8)
Antibodies (2)
Jump to Filters
View as table Download
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824

USD 970.00

In Stock

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMPD4 (NM_017951) Human Tagged ORF Clone
RG219824

USD 1,070.00

In Stock

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164610) Mouse Tagged ORF Clone
MR210696

USD 660.00

In Stock

Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone
MR219037

USD 610.00

In Stock

Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 Human Gene Knockout Kit (CRISPR)
KN414161

USD 1,290.00

2 Weeks

SMPD4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN414161 is the updated version of KN214161.
Smpd4 Mouse Gene Knockout Kit (CRISPR)
KN516347

USD 1,290.00

2 Weeks

Smpd4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN516347 is the updated version of KN316347.
Smpd4 (BC026767) Mouse Tagged ORF Clone
MG210696

USD 730.00

3 Weeks

Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (cDNA clone MGC:30316 IMAGE:5137008)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone
MG216855

USD 910.00

3 Weeks

Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone
MG218291

USD 940.00

3 Weeks

Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4) transcript variant 4, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone
MG219037

USD 670.00

3 Weeks

Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164610) Mouse Tagged ORF Clone
MR210696L3

USD 860.00

3 Weeks

Lenti ORF clone of Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164610) Mouse Tagged ORF Clone Lentiviral Particle
MR210696L3V

USD 1,060.00

6 Weeks

Lenti ORF particles, Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164610) Mouse Tagged ORF Clone
MR210696L4

USD 860.00

3 Weeks

Lenti ORF clone of Smpd4 (mGFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164610) Mouse Tagged ORF Clone Lentiviral Particle
MR210696L4V

USD 1,060.00

6 Weeks

Lenti ORF particles, Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone
MR216855

USD 830.00

3 Weeks

Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone
MR216855L3

USD 1,030.00

4 Weeks

Lenti ORF clone of Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone Lentiviral Particle
MR216855L3V

USD 1,230.00

7 Weeks

Lenti ORF particles, Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone
MR216855L4

USD 1,030.00

4 Weeks

Lenti ORF clone of Smpd4 (mGFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164611) Mouse Tagged ORF Clone Lentiviral Particle
MR216855L4V

USD 1,230.00

7 Weeks

Lenti ORF particles, Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone
MR218291

USD 850.00

4 Weeks

Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone
MR218291L3

USD 1,050.00

9 Weeks

Lenti ORF clone of Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone Lentiviral Particle
MR218291L3V

USD 1,250.00

12 Weeks

Lenti ORF particles, Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone
MR218291L4

USD 1,050.00

9 Weeks

Lenti ORF clone of Smpd4 (mGFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_001164609) Mouse Tagged ORF Clone Lentiviral Particle
MR218291L4V

USD 1,250.00

12 Weeks

Lenti ORF particles, Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone
MR219037L3

USD 810.00

3 Weeks

Lenti ORF clone of Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone Lentiviral Particle
MR219037L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, Smpd4 (Myc-DDK-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone
MR219037L4

USD 810.00

3 Weeks

Lenti ORF clone of Smpd4 (mGFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smpd4 (NM_029945) Mouse Tagged ORF Clone Lentiviral Particle
MR219037L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Smpd4 (GFP-tagged) - Mouse sphingomyelin phosphodiesterase 4 (Smpd4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161

USD 930.00

4 Weeks

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161L3

USD 1,130.00

4 Weeks

Lenti-ORF clone of SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone Lentiviral Particle
RC214161L3V

USD 1,330.00

7 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161L4

USD 1,130.00

4 Weeks

Lenti-ORF clone of SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone Lentiviral Particle
RC214161L4V

USD 1,330.00

7 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824L3

USD 1,170.00

3 Weeks

Lenti ORF clone of Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone Lentiviral Particle
RC219824L3V

USD 1,370.00

6 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824L4

USD 1,170.00

3 Weeks

Lenti ORF clone of Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone Lentiviral Particle
RC219824L4V

USD 1,370.00

6 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482

USD 850.00

4 Weeks

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482L3

USD 1,050.00

4 Weeks

Lenti-ORF clone of SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle
RC230482L3V

USD 1,250.00

7 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482L4

USD 1,050.00

4 Weeks

Lenti-ORF clone of SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle
RC230482L4V

USD 1,250.00

7 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RG214161

USD 1,020.00

5 Weeks

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RG230482

USD 940.00

5 Weeks

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smpd4 (NM_001167806) Rat Tagged ORF Clone
RR217236

USD 830.00

5 Weeks

Smpd4 (myc-DDK-tagged) - Rat sphingomyelin phosphodiesterase 4, neutral membrane (Smpd4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_017951) Human Over-expression Lysate
LY413435

USD 605.00

5 Days

Transient overexpression lysate of sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

SMPD4 (NM_017951) Human Untagged Clone
SC112589

USD 1,760.00

In Stock

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SMPD4 (NM_017751) Human Untagged Clone
SC114022

USD 1,710.00

In Stock

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Smpd4 Mouse qPCR Primer Pair (NM_029945)
MP216125

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Smpd4

SMPD4 Rabbit Polyclonal Antibody
TA342050

USD 375.00

5 Days

Rabbit Polyclonal Anti-Smpd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP