Products

View as table Download

BMP5 (Myc-DDK-tagged)-Human bone morphogenetic protein 5 (BMP5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, BMP5 (Myc-DDK tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, BMP5 (mGFP-tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

BMP5 (GFP-tagged) - Human bone morphogenetic protein 5 (BMP5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, BMP5 (Myc-DDK tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, BMP5 (mGFP-tagged) - Human bone morphogenetic protein 5 (BMP5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human bone morphogenetic protein 5 (BMP5).

Tag Tag Free
Expression Host CHO

BMP5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

BMP5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human bone morphogenetic protein 5 (BMP5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

BMP5 (untagged)-Human bone morphogenetic protein 5 (BMP5)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-BMP5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

BMP5 Rabbit Polyclonal (aa31-46) Antibody

Applications IHC
Reactivities Human
Immunogen BMP5 antibody was raised against synthetic peptide from human BMP5.

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human BMP-5

Rabbit polyclonal anti-BMP-5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 29 of human BMP-5

BMP5 (317-454) human recombinant protein, 0.5 mg

Expression Host E. coli

BMP5 (317-454) human recombinant protein, 0.1 mg

Expression Host E. coli

USD 1,070.00

4 Weeks

Transient overexpression of BMP5 (NM_021073) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of BMP5 (NM_021073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of BMP5 (NM_021073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack