DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DLL3 (untagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
DLL3 (GFP-tagged) - Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
DLL3 (GFP-tagged) - Human delta-like 3 (Drosophila) (DLL3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of delta-like 3 (Drosophila) (DLL3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF particles, DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3. |
Rabbit Polyclonal DLL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody. |
Lenti-ORF clone of DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DLL3 (untagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL |
DLL3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
Transient overexpression of DLL3 (NM_016941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DLL3 (NM_203486) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DLL3 (NM_016941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DLL3 (NM_203486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack