Products

cDNA Clones (54)
Proteins (11)
Antibodies (7)
Jump to Filters
View as table Download
XPD (ERCC2) (NM_000400) Human Tagged ORF Clone
RC215058L1

USD 1,008.00

In Stock

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
XPD (ERCC2) (NM_000400) Human Over-expression Lysate
LY400141

USD 605.00

In Stock

Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
XPD (ERCC2) (NM_000400) Human Untagged Clone
SC106224

USD 760.00

In Stock

ERCC2 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
XPD (ERCC2) Rabbit Polyclonal Antibody
TA590019

USD 409.00

In Stock

Rabbit Polyclonal XPD Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
XPD (ERCC2) (NM_000400) Human Over-expression Lysate
LC400141

USD 187.00

In Stock

ERCC2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
XPD (ERCC2) (NM_001130867) Human Over-expression Lysate
LY427299

USD 396.00

In Stock

Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
XPD (ERCC2) (NM_000400) Human Tagged ORF Clone
RC215058L2

USD 810.00

3 Weeks

Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
XPD (ERCC2) (NM_001130867) Human Over-expression Lysate
LC427299

USD 121.00

In Stock

ERCC2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
XPD (ERCC2) Rabbit Polyclonal Antibody
TA330046

USD 375.00

5 Days

Rabbit Polyclonal Anti-ERCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF804192

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPD (ERCC2) (NM_001130867) Human Untagged Clone
SC325890

USD 690.00

3 Weeks

ERCC2 (untagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA804192

USD 379.00

In Stock

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPD (ERCC2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B11]
TA804192BM

USD 420.00

4 Weeks

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA804192S

USD 159.00

2 Days

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPD (ERCC2) ICC Control Block
TB415058

USD 1,260.00

4 Weeks

Transient overexpression of ERCC2 (NM_000400) in HEK293T cells paraffin embedded controls for ICC/IHC staining

XPD (ERCC2) ICC Control Block
TB425633

USD 1,070.00

4 Weeks

Transient overexpression of ERCC2 (NM_001130867) in HEK293T cells paraffin embedded controls for ICC/IHC staining

XPD (ERCC2) (NM_000400) Human Recombinant Protein
TP762657

USD 261.00

2 Weeks

Purified recombinant protein of Human excision repair cross-complementing rodent repair deficiency, complementation group 2 (ERCC2), transcript variant 1, full length, with N-GST and C-His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli
XPD (ERCC2) Cytosection
TS415058

USD 225.00

4 Weeks

Transient overexpression of ERCC2 (NM_000400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

XPD (ERCC2) Cytosection
TS415058P5

USD 889.00

4 Weeks

Transient overexpression of ERCC2 (NM_000400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

XPD (ERCC2) Cytosection
TS425633

USD 225.00

4 Weeks

Transient overexpression of ERCC2 (NM_001130867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

XPD (ERCC2) Cytosection
TS425633P5

USD 889.00

4 Weeks

Transient overexpression of ERCC2 (NM_001130867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack