IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Homo sapiens interleukin 4 (IL4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4 (Myc-DDK tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4 (mGFP-tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1.
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1
Tag | Tag Free |
Expression Host | E. coli |
IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Interleukin-4 / IL4 human recombinant protein, 10 µg
Expression Host | E. coli |
Interleukin-4 / IL4 human recombinant protein, 2 µg
Expression Host | E. coli |
Interleukin-4 / IL4 human recombinant protein, 50 µg
Expression Host | E. coli |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Anti-Human IL-4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-IL4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL4. |
Rabbit polyclonal IL4 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Recombinant protein of human Interleukin 4 (IL-4) produced in E. coli.
Tag | Tag Free |
Expression Host | E. coli |
Recombinant protein of human interleukin 4 (IL4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
IL4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interleukin 4 (IL4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human IL-4 |
Mouse Anti-Human IL-4 Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of IL4 (NM_172348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
IL4 mouse monoclonal antibody, clone B-S4, Azide Free
Applications | FN |
Reactivities | Human |
IL4 mouse monoclonal antibody, clone B-G28, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL4 mouse monoclonal antibody, clone 8F-12, Aff - Purified
Applications | FC |
Reactivities | Human |
IL4 mouse monoclonal antibody, clone 8F-12, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Biotinylated Anti-Human IL-4 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |