Products

cDNA Clones (8)
Proteins (6)
Antibodies (1)
Jump to Filters
View as table Download
Methionyl tRNA synthetase (MARS) (NM_004990) Human Tagged ORF Clone Lentiviral Particle
RC202932L3V

USD 1,400.00

6 Weeks

Lenti ORF particles, MARS (Myc-DDK tagged) - Human methionyl-tRNA synthetase (MARS), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Methionyl tRNA synthetase (MARS) (AK092986) Human Untagged Clone
SC127390

USD 660.00

In Stock

(untagged)-Human cDNA FLJ35667 fis, clone SPLEN2018098, highly similar to METHIONYL-TRNA SYNTHETASE (EC 6.1.1.10)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Methionyl tRNA synthetase (MARS) Rabbit Polyclonal Antibody
TA331113

USD 375.00

5 Days

Rabbit Polyclonal Anti-MARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ
Methionyl tRNA synthetase (MARS) (NM_004990) Human Over-expression Lysate
LC417604

USD 121.00

2 Weeks

MARS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Methionyl tRNA synthetase (MARS) ICC Control Block
TB402932

USD 1,650.00

4 Weeks

Transient overexpression of MARS (NM_004990) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Methionyl tRNA synthetase (MARS) Cytosection
TS402932

USD 225.00

4 Weeks

Transient overexpression of MARS (NM_004990) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Methionyl tRNA synthetase (MARS) Cytosection
TS402932P5

USD 889.00

4 Weeks

Transient overexpression of MARS (NM_004990) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack