Products

Antibodies (23)
Proteins (22)
cDNA Clones (18)
Jump to Filters
View as table Download
IL4 Capture Mouse Monoclonal Antibody [Clone ID: OTI8D4]
TA600022

USD 379.00

In Stock

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022
IL4 (NM_172348) Human Tagged ORF Clone
RC213286

USD 98.00

USD 390.00

In Stock

IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IL4 (NM_000589) Human Tagged ORF Clone
RC209972

USD 520.00

In Stock

IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4 (NM_000589) Human Tagged ORF Clone
RG209972

USD 570.00

In Stock

IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4 (NM_000589) Human Tagged ORF Clone Lentiviral Particle
RC209972L1V

USD 920.00

3 Weeks

Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IL4 (NM_000589) Human Tagged ORF Clone Lentiviral Particle
RC209972L2V

USD 920.00

6 Weeks

Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IL4 (NM_172348) Human Tagged ORF Clone
RG213286

USD 460.00

In Stock

IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IL4 (NM_000589) Human Tagged ORF Clone
RC209972L3

USD 720.00

3 Weeks

Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_000589) Human Tagged ORF Clone Lentiviral Particle
RC209972L3V

USD 920.00

5 Weeks

Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_000589) Human Tagged ORF Clone
RC209972L4

USD 720.00

In Stock

Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_000589) Human Tagged ORF Clone Lentiviral Particle
RC209972L4V

USD 920.00

3 Weeks

Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_172348) Human Tagged ORF Clone
RC213286L3

USD 620.00

3 Weeks

Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_172348) Human Tagged ORF Clone Lentiviral Particle
RC213286L3V

USD 820.00

6 Weeks

Lenti ORF particles, IL4 (Myc-DDK tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_172348) Human Tagged ORF Clone
RC213286L4

USD 620.00

In Stock

Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_172348) Human Tagged ORF Clone Lentiviral Particle
RC213286L4V

USD 820.00

3 Weeks

Lenti ORF particles, IL4 (mGFP-tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL4 (NM_000589) Human Untagged Clone
SC300104

USD 420.00

In Stock

IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
IL4 (NM_000589) Human Tagged Lenti ORF Clone
RC209972L1

USD 888.00

In Stock

Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IL4 (NM_000589) Human Recombinant Protein
TP723234

USD 240.00

2 Weeks

Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1.

Tag Tag Free
Expression Host E. coli
IL4 (NM_000589) Human Recombinant Protein
TP723731

USD 205.00

5 Days

Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1

Tag Tag Free
Expression Host E. coli
IL4 (NM_172348) Human Untagged Clone
SC306756

USD 420.00

In Stock

IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Interleukin-4 / IL4 (25-153, His-tag) Human Protein
AR09136PU-L

USD 1,620.00

2 Weeks

Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Interleukin-4 / IL4 (25-153, His-tag) Human Protein
AR09136PU-N

USD 590.00

2 Weeks

Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Interleukin-4 / IL4 Human Protein
DA3546

USD 210.00

2 Weeks

Interleukin-4 / IL4 human recombinant protein, 10 µg

Expression Host E. coli
Interleukin-4 / IL4 Human Protein
DA3546S

USD 155.00

2 Weeks

Interleukin-4 / IL4 human recombinant protein, 2 µg

Expression Host E. coli
Interleukin-4 / IL4 Human Protein
DA3546X

USD 455.00

2 Weeks

Interleukin-4 / IL4 human recombinant protein, 50 µg

Expression Host E. coli
IL4 Rabbit Polyclonal Antibody
TA347886

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4
IL4 Rabbit Polyclonal Antibody
PP1026P2

USD 355.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)
IL4 Rabbit Polyclonal Antibody
TA328211

USD 285.00

5 Days

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4
IL4 Rabbit Polyclonal Antibody
PP1026P1

USD 260.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)
IL4 (NM_000589) Human Tagged ORF Clone
RC209972L2

USD 720.00

3 Weeks

Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IL4 Rabbit Polyclonal Antibody
TA313321

USD 345.00

In Stock

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.
IL4 Rabbit Polyclonal Antibody
TA324803

USD 450.00

5 Days

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.
IL4 (NM_000589) Human Recombinant Protein
TP750015

USD 425.00

In Stock

Recombinant protein of human Interleukin 4 (IL-4) produced in E. coli.

Tag Tag Free
Expression Host E. coli
IL4 (NM_000589) Human Recombinant Protein
TP760207

USD 215.00

In Stock

Recombinant protein of human interleukin 4 (IL4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
IL4 (NM_172348) Human Over-expression Lysate
LC406716

USD 121.00

In Stock

IL4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL4 (NM_172348) Human Over-expression Lysate
LY406716

USD 396.00

5 Days

Transient overexpression lysate of interleukin 4 (IL4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IL4 Rabbit Polyclonal Antibody
TA319039

USD 415.00

3 Weeks

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4
IL4 Mouse Monoclonal Antibody [Clone ID: 8D4-8]
TA320372

USD 160.00

5 Days

Mouse Anti-Human IL-4 Purified (50 ug)

Reactivities Human
Conjugation Unconjugated
IL4 CytoSection
TS413286P5

USD 978.00

In Stock

Transient overexpression of IL4 (NM_172348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL4 Mouse Monoclonal Antibody [Clone ID: B-S4]
AM31261AF-N

USD 470.00

2 Weeks

IL4 mouse monoclonal antibody, clone B-S4, Azide Free

Applications FN
Reactivities Human
IL4 Mouse Monoclonal Antibody [Clone ID: B-G28]
AM31266RP-N

USD 340.00

2 Weeks

IL4 mouse monoclonal antibody, clone B-G28, PE

Applications FC
Reactivities Human
Conjugation PE
IL4 Mouse Monoclonal Antibody [Clone ID: 8F-12]
AM39038PU-N

USD 410.00

2 Weeks

IL4 mouse monoclonal antibody, clone 8F-12, Aff - Purified

Applications FC
Reactivities Human
IL4 Mouse Monoclonal Antibody [Clone ID: 8F-12]
AM39038RP-N

USD 640.00

2 Weeks

IL4 mouse monoclonal antibody, clone 8F-12, PE

Applications FC
Reactivities Human
Conjugation PE
IL4 Rabbit Polyclonal Antibody
AP20623PU-N

USD 370.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
IL4 Rabbit Polyclonal Antibody
TA319286

USD 530.00

5 Days

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.
IL4 Rabbit Polyclonal Antibody
TA319287

USD 540.00

5 Days

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.
IL4 Rabbit Polyclonal Antibody
TA319288

USD 540.00

5 Days

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.
IL4 Goat Polyclonal Antibody
TA328210

USD 285.00

5 Days

Biotinylated Anti-Human IL-4 Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4
IL4 Rabbit Polyclonal Antibody
TA336229

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC