PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PDE1A (Myc-DDK tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDE1A (mGFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PDE1A (GFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE1A (Myc-DDK tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE1A (mGFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE1A (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE1A (GFP-tagged) - Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE1A (GFP-tagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to PDE1A (phosphodiesterase 1A, calmodulin-dependent)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 212 and 535 of PDE1A (Uniprot ID#P54750) |
Goat Anti-PDE1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DLHKNSEDLVNAE, from the C Terminus of the protein sequence according to NP_005010.2. |
PDE1A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-PDE1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE1A MS Standard C13 and N15-labeled recombinant protein (NP_005010)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE1A mouse monoclonal antibody,clone 5C9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDE1A mouse monoclonal antibody,clone 5C9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |