Products

cDNA Clones (14)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
Cyclin B3 (CCNB3) (NM_033031) Human Tagged ORF Clone
RC217591

USD 1,460.00

In Stock

CCNB3 (Myc-DDK-tagged)-Human cyclin B3 (CCNB3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin B3 (CCNB3) (NM_033031) Human Tagged ORF Clone
RC217591L3

USD 1,660.00

3 Weeks

Lenti-ORF clone of CCNB3 (Myc-DDK-tagged)-Human cyclin B3 (CCNB3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin B3 (CCNB3) (NM_033031) Human Tagged ORF Clone
RC217591L4

USD 1,660.00

3 Weeks

Lenti-ORF clone of CCNB3 (mGFP-tagged)-Human cyclin B3 (CCNB3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin B3 (CCNB3) (NM_033670) Human Tagged ORF Clone
RC222550

USD 420.00

3 Weeks

CCNB3 (Myc-DDK-tagged)-Human cyclin B3 (CCNB3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin B3 (CCNB3) (NM_033670) Human Tagged ORF Clone
RC222550L3

USD 620.00

8 Weeks

Lenti-ORF clone of CCNB3 (Myc-DDK-tagged)-Human cyclin B3 (CCNB3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin B3 (CCNB3) (NM_033670) Human Tagged ORF Clone
RC222550L4

USD 620.00

8 Weeks

Lenti-ORF clone of CCNB3 (mGFP-tagged)-Human cyclin B3 (CCNB3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclin B3 (CCNB3) (NM_033031) Human Tagged ORF Clone
RG217591

USD 1,610.00

3 Weeks

CCNB3 (GFP-tagged) - Human cyclin B3 (CCNB3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin B3 (CCNB3) (NM_033670) Human Tagged ORF Clone
RG222550

USD 460.00

3 Weeks

CCNB3 (GFP-tagged) - Human cyclin B3 (CCNB3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody
TA345467

USD 475.00

5 Days

Rabbit Polyclonal Anti-CCNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3. Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE
Cyclin B3 (CCNB3) (NM_033670) Human Untagged Clone
SC110710

USD 660.00

In Stock

CCNB3 (untagged)-Human cyclin B3 (CCNB3), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody
TA345466

USD 410.00

5 Days

Rabbit Polyclonal Anti-CCNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody
TA341424

USD 310.00

5 Days

Rabbit Polyclonal Anti-CCNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Cyclin B3 (CCNB3) (NM_033031) Human Untagged Clone
SC305536

USD 2,830.00

4 Weeks

CCNB3 (untagged)-Human cyclin B3 (CCNB3), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Cyclin B3 (CCNB3) (NM_033031) ICC Control Block
TB417591

USD 2,110.00

4 Weeks

Transient overexpression of CCNB3 (NM_033031) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cyclin B3 (CCNB3) (NM_033670) ICC Control Block
TB422550

USD 1,070.00

4 Weeks

Transient overexpression of CCNB3 (NM_033670) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cyclin B3 (CCNB3) Cytosection
TS417591

USD 225.00

4 Weeks

Transient overexpression of CCNB3 (NM_033031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cyclin B3 (CCNB3) Cytosection
TS417591P5

USD 889.00

4 Weeks

Transient overexpression of CCNB3 (NM_033031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cyclin B3 (CCNB3) ICC Control Sections
TS422550P5

USD 889.00

4 Weeks

Transient overexpression of CCNB3 (NM_033670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack