Products

cDNA Clones (46)
Proteins (26)
Antibodies (19)
Jump to Filters
View as table Download
CDC25B (NM_021873) Human Tagged ORF Clone
RC207409

USD 420.00

In Stock

CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC25B (NM_021873) Human Tagged ORF Clone Lentiviral Particle
RC207409L1V

USD 820.00

3 Weeks

Lenti ORF particles, CDC25B (Myc-DDK tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDC25B (NM_021873) Human Tagged ORF Clone Lentiviral Particle
RC207409L2V

USD 820.00

6 Weeks

Lenti ORF particles, CDC25B (mGFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDC25B (NM_021872) Human Tagged ORF Clone
RC215766

USD 500.00

In Stock

CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_021873) Human Tagged ORF Clone
RG207409

USD 460.00

In Stock

CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_021872) Human Tagged ORF Clone
RG215766

USD 550.00

In Stock

CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_021873) Human Tagged ORF Clone
RC207409L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021873) Human Tagged ORF Clone Lentiviral Particle
RC207409L3V

USD 820.00

5 Weeks

Lenti ORF particles, CDC25B (Myc-DDK tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021873) Human Tagged ORF Clone
RC207409L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021873) Human Tagged ORF Clone Lentiviral Particle
RC207409L4V

USD 820.00

7 Weeks

Lenti ORF particles, CDC25B (mGFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021872) Human Tagged ORF Clone
RC215766L3

USD 700.00

3 Weeks

Lenti-ORF clone of CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021872) Human Tagged ORF Clone Lentiviral Particle
RC215766L3V

USD 900.00

6 Weeks

Lenti ORF particles, CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021872) Human Tagged ORF Clone
RC215766L4

USD 700.00

3 Weeks

Lenti-ORF clone of CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_021872) Human Tagged ORF Clone Lentiviral Particle
RC215766L4V

USD 900.00

6 Weeks

Lenti ORF particles, CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_004358) Human Tagged ORF Clone
RC216838

USD 530.00

4 Weeks

CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_004358) Human Tagged ORF Clone
RC216838L3

USD 730.00

4 Weeks

Lenti-ORF clone of CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_004358) Human Tagged ORF Clone Lentiviral Particle
RC216838L3V

USD 930.00

7 Weeks

Lenti ORF particles, CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_004358) Human Tagged ORF Clone
RC216838L4

USD 730.00

4 Weeks

Lenti-ORF clone of CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_004358) Human Tagged ORF Clone Lentiviral Particle
RC216838L4V

USD 930.00

7 Weeks

Lenti ORF particles, CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC25B (NM_001287524) Human Tagged ORF Clone
RC237904

USD 420.00

2 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 10

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287522) Human Tagged ORF Clone
RC238160

USD 420.00

2 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287519) Human Tagged ORF Clone
RC238402

USD 490.00

2 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287520) Human Tagged ORF Clone
RC238403

USD 490.00

2 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287518) Human Tagged ORF Clone
RC238523

USD 420.00

2 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287517) Human Tagged ORF Clone
RC238590

USD 480.00

3 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287516) Human Tagged ORF Clone
RC238677

USD 480.00

3 Weeks

CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_004358) Human Tagged ORF Clone
RG216838

USD 580.00

5 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_021873) Human Untagged Clone
SC126594

USD 760.00

In Stock

CDC25B (untagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDC25B Rabbit Polyclonal Antibody
TA346009

USD 475.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE
CDC25B (NM_021873) Human Tagged ORF Clone
RC207409L1

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDC25B (NM_021873) Human Over-expression Lysate
LY402883

USD 396.00

5 Days

Transient overexpression lysate of cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC25B Rabbit Polyclonal Antibody
TA346010

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cdc25b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK
CDC25B (NM_021873) Human Tagged ORF Clone
RC207409L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDC25B Rabbit Polyclonal Antibody
TA313189

USD 345.00

In Stock

Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P).
Modifications Phospho-specific
CDC25B Rabbit Polyclonal Antibody
TA325329

USD 345.00

In Stock

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B
CDC25B Rabbit Polyclonal Antibody
TA325330

USD 345.00

In Stock

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B
CDC25B Rabbit Polyclonal Antibody
TA325331

USD 345.00

In Stock

Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323
Modifications Phospho-specific
CDC25B (NM_021873) Human Over-expression Lysate
LC402883

USD 121.00

In Stock

CDC25B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC25B Rabbit Polyclonal Antibody
TA325332

USD 345.00

4 Weeks

Rabbit Polyclonal CDC25B (Ser353) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 353
Modifications Phospho-specific
CDC25B Rabbit Polyclonal Antibody
TA330366

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS
CDC25B Mouse Monoclonal Antibody [Clone ID: OTI11C5]
CF812342

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI11C5

Applications WB
Reactivities Human
Conjugation Unconjugated
CDC25B Mouse Monoclonal Antibody [Clone ID: OTI6H9]
CF812352

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI6H9

Applications WB
Reactivities Human
Conjugation Unconjugated
CDC25B (NM_021872) Human Over-expression Lysate
LC411901

USD 187.00

2 Weeks

CDC25B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC25B (NM_021872) Human Over-expression Lysate
LY411901

USD 605.00

5 Days

Transient overexpression lysate of cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC25B (NM_001287524) Human Tagged ORF Clone
RG237904

USD 460.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 10

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287522) Human Tagged ORF Clone
RG238160

USD 460.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287519) Human Tagged ORF Clone
RG238402

USD 530.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287520) Human Tagged ORF Clone
RG238403

USD 530.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287518) Human Tagged ORF Clone
RG238523

USD 460.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC25B (NM_001287517) Human Tagged ORF Clone
RG238590

USD 520.00

2 Weeks

CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®