Germany
Japan
United Kingdom
China
ORC6 (Myc-DDK-tagged)-Human origin recognition complex, subunit 6 (ORC6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human origin recognition complex, subunit 6 like (yeast) (ORC6L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ORC6 (GFP-tagged) - Human origin recognition complex, subunit 6 (ORC6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human origin recognition complex, subunit 6 (ORC6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ORC6 (Myc-DDK tagged) - Human origin recognition complex, subunit 6 (ORC6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human origin recognition complex, subunit 6 (ORC6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ORC6 (mGFP-tagged) - Human origin recognition complex, subunit 6 (ORC6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of origin recognition complex, subunit 6 like (yeast) (ORC6L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ORC6 (untagged)-Human origin recognition complex, subunit 6 (ORC6), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ORC6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-ORC6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ENAASAQKATAE, from the C Terminus of the protein sequence according to NP_055136.1. |
Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody is: synthetic peptide directed towards the N-terminal region of Human ORC6. Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS |
Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody: synthetic peptide directed towards the C terminal of human ORC6. Synthetic peptide located within the following region: VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE |
ORC6 (1-252, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
ORC6 (1-252, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
ORC6L MS Standard C13 and N15-labeled recombinant protein (NP_055136)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ORC6 (NM_014321) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ORC6 (NM_014321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ORC6 (NM_014321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ORC6
Families
- Druggable Genome
Pathways
- Cell cycle