TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human thyroid peroxidase (TPO), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,150.00
3 Weeks
Lenti ORF particles, TPO (Myc-DDK tagged) - Human thyroid peroxidase (TPO), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,150.00
6 Weeks
Lenti ORF particles, TPO (mGFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TPO (Myc-DDK tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human thyroid peroxidase (TPO), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
7 Weeks
Lenti ORF particles, TPO (Myc-DDK tagged) - Human thyroid peroxidase (TPO), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human thyroid peroxidase (TPO), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
7 Weeks
Lenti ORF particles, TPO (mGFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,250.00
7 Weeks
Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,250.00
7 Weeks
Lenti ORF particles, TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
8 Weeks
Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
8 Weeks
Lenti ORF particles, TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,390.00
8 Weeks
Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,390.00
8 Weeks
Lenti ORF particles, TPO (mGFP-tagged)-Human thyroid peroxidase (TPO), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPO (Myc-DDK tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (GFP-tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPO (untagged)-Human thyroid peroxidase (TPO), transcript variant 1
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of thyroid peroxidase (TPO), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human thyroid peroxidase (TPO), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TPO HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against thyroid peroxidase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS |
TPO MS Standard C13 and N15-labeled recombinant protein (NP_000538)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TPO (untagged)-Human thyroid peroxidase (TPO), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
TPO (untagged)-Human thyroid peroxidase (TPO), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
TPO (untagged)-Human thyroid peroxidase (TPO), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
TPO (untagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
TPO (untagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 7
Vector | pCMV6 series |
Tag | Tag Free |
Anti-TPO Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of TPO (NM_000547) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPO (NM_175722) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPO (NM_175719) in HEK293T cells paraffin embedded controls for ICC/IHC staining