Products

cDNA Clones (17)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RC204745

USD 420.00

In Stock

UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone Lentiviral Particle
RC204745L2V

USD 820.00

6 Weeks

Lenti ORF particles, UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RC204745L3

USD 620.00

3 Weeks

Lenti-ORF clone of UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone Lentiviral Particle
RC204745L3V

USD 820.00

11 Weeks

Lenti ORF particles, UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RC204745L4

USD 620.00

3 Weeks

Lenti-ORF clone of UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone Lentiviral Particle
RC204745L4V

USD 820.00

11 Weeks

Lenti ORF particles, UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT2B4) (NM_001297615) Human Tagged ORF Clone
RC237774

USD 420.00

2 Weeks

UGT2B4 (myc-DDK-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_001297616) Human Tagged ORF Clone
RC237933

USD 420.00

2 Weeks

UGT2B4 (myc-DDK-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RG204745

USD 460.00

3 Weeks

UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_021139) Human Untagged Clone
SC112983

USD 310.00

In Stock

UGT2B4 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RC204745L1

USD 620.00

In Stock

Lenti-ORF clone of UGT2B4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UGT (UGT2B4) (NM_021139) Human Tagged ORF Clone
RC204745L2

USD 620.00

3 Weeks

Lenti-ORF clone of UGT2B4 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGT (UGT2B4) Rabbit Polyclonal Antibody
TA338455

USD 375.00

5 Days

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE
UGT (UGT2B4) (NM_001297615) Human Tagged ORF Clone
RG237774

USD 460.00

2 Weeks

UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_001297616) Human Tagged ORF Clone
RG237933

USD 460.00

2 Weeks

UGT2B4 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT2B4) (NM_001297615) Human Untagged Clone
SC335668

USD 370.00

2 Weeks

UGT2B4 (untagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UGT (UGT2B4) (NM_001297616) Human Untagged Clone
SC335827

USD 390.00

2 Weeks

UGT2B4 (untagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B4 (UGT2B4), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UGT (UGT2B4) Rabbit Polyclonal Antibody
TA350581

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4
UGT (UGT2B4) ICC Control Block
TB404745

USD 1,070.00

4 Weeks

Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT (UGT2B4) ICC Control Block
TB437774

USD 1,070.00

4 Weeks

Transient overexpression of UGT2B4 (NM_001297615) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT (UGT2B4) ICC Control Block
TB437933

USD 1,070.00

4 Weeks

Transient overexpression of UGT2B4 (NM_001297616) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT (UGT2B4) Cytosection
TS404745

USD 225.00

10 Weeks

Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT (UGT2B4) Cytosection
TS404745P5

USD 889.00

4 Weeks

Transient overexpression of UGT2B4 (NM_021139) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

UGT (UGT2B4) ICC Control Sections
TS437774P5

USD 889.00

4 Weeks

Transient overexpression of UGT2B4 (NM_001297615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

UGT (UGT2B4) ICC Control Sections
TS437933P5

USD 889.00

4 Weeks

Transient overexpression of UGT2B4 (NM_001297616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack