Products

cDNA Clones (14)
Proteins (12)
Antibodies (5)
Jump to Filters
View as table Download
alpha Tubulin (TUBA3C) (NM_006001) Human Tagged ORF Clone
RC213499

USD 420.00

In Stock

TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
alpha Tubulin (TUBA3C) (NM_079836) Human Tagged ORF Clone
RG204072

USD 480.00

In Stock

TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Tubulin (TUBA3C) (NM_079836) Human Tagged ORF Clone Lentiviral Particle
RC204072L3V

USD 840.00

6 Weeks

Lenti ORF particles, TUBA3C (Myc-DDK tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha Tubulin (TUBA3C) (NM_006001) Human Tagged ORF Clone
RG213499

USD 460.00

3 Weeks

TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Tubulin (TUBA3C) Rabbit Polyclonal Antibody
TA349093

USD 484.00

5 Days

Rabbit Polyclonal Anti-UVRAG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG.
TUBA3D Mouse Monoclonal Antibody [Clone ID: 3F10-2F2]
AM21026PU-N

USD 480.00

2 Weeks

TUBA3D mouse monoclonal antibody, clone 3F10-2F2

Applications ELISA, IF, IHC, WB
Reactivities Human
alpha Tubulin (TUBA3C) (NM_006001) Human Over-expression Lysate
LC416933

USD 187.00

In Stock

TUBA3C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha Tubulin (TUBA3C) (NM_006001) Human Over-expression Lysate
LY416933

USD 605.00

In Stock

Transient overexpression lysate of tubulin, alpha 3c (TUBA3C)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha Tubulin (TUBA3C) (NM_079836) Human Untagged Clone
SC123106

USD 900.00

In Stock

TUBA3C (untagged)-Human tubulin, alpha 3c (TUBA3C), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
alpha Tubulin (TUBA3C) Rabbit Polyclonal Antibody
TA335702

USD 375.00

5 Days

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL
alpha Tubulin (TUBA3C) Rabbit Polyclonal Antibody
TA319730

USD 430.00

5 Days

Rabbit Polyclonal Alpha-tubulin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin.
alpha Tubulin (TUBA3C) Rabbit Polyclonal Antibody
TA335701

USD 375.00

5 Days

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR
alpha Tubulin (TUBA3C) (NM_079836) Human Over-expression Lysate
LC409205

USD 121.00

2 Weeks

TUBA3C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha Tubulin (TUBA3C) (NM_079836) Human Over-expression Lysate
LY409205

USD 396.00

5 Days

Transient overexpression lysate of tubulin, alpha 3c (TUBA3C), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha Tubulin (TUBA3C) (NM_079836) Human Mass Spec Standard
PH304072

USD 2,055.00

3 Weeks

TUBA3C MS Standard C13 and N15-labeled recombinant protein (NP_524575)

Tag C-Myc/DDK
Expression Host HEK293
alpha Tubulin (TUBA3C) (NM_006001) Human Untagged Clone
SC303718

USD 760.00

3 Weeks

TUBA3C (untagged)-Human tubulin, alpha 3c (TUBA3C)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
alpha Tubulin (TUBA3C) ICC Control Block
TB404072

USD 1,090.00

4 Weeks

Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha Tubulin (TUBA3C) ICC Control Block
TB413499

USD 1,070.00

4 Weeks

Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha Tubulin (TUBA3C) Cytosection
TS404072

USD 225.00

4 Weeks

Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

alpha Tubulin (TUBA3C) ICC Control Sections
TS404072P5

USD 889.00

4 Weeks

Transient overexpression of TUBA3C (NM_079836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

alpha Tubulin (TUBA3C) Cytosection
TS413499

USD 225.00

4 Weeks

Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

alpha Tubulin (TUBA3C) Cytosection
TS413499P5

USD 889.00

4 Weeks

Transient overexpression of TUBA3C (NM_006001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack