GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GCDH (GFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GCDH (Myc-DDK tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GCDH (mGFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GCDH (mGFP-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GCDH (mGFP-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GCDH (GFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GCDH (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 335-365 amino acids from the C-terminal region of Human GCD / GCDH |
GCDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GCDH (untagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GCDH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the C terminal of human GCDH. Synthetic peptide located within the following region: IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG |
Rabbit Polyclonal Anti-Gcdh Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
Rabbit Polyclonal Anti-GCDH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the N terminal of human GCDH. Synthetic peptide located within the following region: SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA |
GCD / GCDH (45-438, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
GCD / GCDH (45-438, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
GCDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GCDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GCDH MS Standard C13 and N15-labeled recombinant protein (NP_000150)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GCDH (untagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of GCDH (NM_000159) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GCDH (NM_013976) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of GCDH (NM_000159) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GCDH (NM_000159) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GCDH (NM_013976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GCDH (NM_013976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack