Products

cDNA Clones (37)
Proteins (19)
Antibodies (5)
Jump to Filters
View as table Download
Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Tagged ORF Clone Lentiviral Particle
RC205434L3V

USD 820.00

5 Weeks

Lenti ORF particles, ACVR1C (Myc-DDK tagged) - Human activin A receptor, type IC (ACVR1C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Tagged ORF Clone Lentiviral Particle
RC205434L4V

USD 820.00

3 Weeks

Lenti ORF particles, ACVR1C (mGFP-tagged) - Human activin A receptor, type IC (ACVR1C), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Tagged ORF Clone Lentiviral Particle
RC225494L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACVR1C (Myc-DDK tagged) - Human activin A receptor, type IC (ACVR1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Tagged ORF Clone Lentiviral Particle
RC225494L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACVR1C (mGFP-tagged) - Human activin A receptor, type IC (ACVR1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111032) Human Tagged ORF Clone Lentiviral Particle
RC225649L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACVR1C (Myc-DDK-tagged)-Human activin A receptor, type IC (ACVR1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111032) Human Tagged ORF Clone Lentiviral Particle
RC225649L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACVR1C (mGFP-tagged)-Human activin A receptor, type IC (ACVR1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111031) Human Tagged ORF Clone Lentiviral Particle
RC225725L3V

USD 870.00

6 Weeks

Lenti ORF particles, ACVR1C (Myc-DDK-tagged)-Human activin A receptor, type IC (ACVR1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_001111031) Human Tagged ORF Clone Lentiviral Particle
RC225725L4V

USD 870.00

6 Weeks

Lenti ORF particles, ACVR1C (mGFP-tagged)-Human activin A receptor, type IC (ACVR1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Untagged Clone
SC310329

USD 760.00

In Stock

ACVR1C (untagged)-Human activin A receptor, type IC (ACVR1C), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC310329 is the updated version of SC100186.
Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Over-expression Lysate
LY403426

USD 396.00

5 Days

Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA316098

USD 345.00

In Stock

Rabbit polyclonal anti-ACTR-1C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACTR-1C.
Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA319010

USD 370.00

3 Weeks

Rabbit polyclonal anti-ACVR1C (ALK7) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 155 of mouse ALK-7
Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Untagged Clone
SC323474

USD 760.00

In Stock

ACVR1C (untagged)-Kinase deficient mutant (K142M) of Human activin A receptor, type IC (ACVR1C), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA340402

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACVR1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Over-expression Lysate
LY426339

USD 396.00

In Stock

Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Activin A Receptor Type IC (ACVR1C) (NM_145259) Human Recombinant Protein
TP761292

USD 215.00

In Stock

Purified recombinant protein of Human activin A receptor, type IC (ACVR1C), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Activin A Receptor Type IC (ACVR1C) (NM_001111031) Human Over-expression Lysate
LY426337

USD 396.00

5 Days

Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA323774

USD 345.00

In Stock

Anti-ACVR1C Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-485 amino acids of human activin A receptor, type IC
Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA323775

USD 345.00

In Stock

Anti-ACVR1C Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-485 amino acids of human activin A receptor, type IC