ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADAM15 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ADAM15 (mGFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM15 (mGFP-tagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM15 (Myc-DDK tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM15 (GFP-tagged) - Homo sapiens ADAM metallopeptidase domain 15 (ADAM15), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ADAM15 (untagged)-Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ADAM15 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ADAM15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ |
Transient overexpression lysate of ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |