EMR1 (Myc-DDK-tagged)-Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
EMR1 (Myc-DDK-tagged)-Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADGRE1 (Myc-DDK tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADGRE1 (mGFP-tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EMR1 (Myc-DDK tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EMR1 (GFP-tagged) - Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EMR1 (GFP-tagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to EMR1 (egf-like module containing, mucin-like, hormone receptor-like 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 626 and 886 of EMR1 (Uniprot ID#Q14246) |
EMR1 (untagged)-Human egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-EMR1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1. |
Rabbit Polyclonal Anti-EMR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG |
Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%). |
EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
EMR1 (untagged) - Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 1 (EMR1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADGRE1 (NM_001256255) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADGRE1 (NM_001256254) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADGRE1 (NM_001256252) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADGRE1 (NM_001256253) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADGRE1 (NM_001974) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADGRE1 (NM_001256255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADGRE1 (NM_001256254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADGRE1 (NM_001256252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADGRE1 (NM_001256253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack