Products

cDNA Clones (37)
Proteins (35)
Antibodies (8)
Jump to Filters
View as table Download
Annexin A2 (ANXA2) (NM_001002857) Human Tagged ORF Clone
RG205081

USD 460.00

In Stock

ANXA2 (GFP-tagged) - Human annexin A2 (ANXA2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Annexin A2 (ANXA2) (NM_001002858) Human Tagged ORF Clone
RG215009

USD 460.00

In Stock

ANXA2 (GFP-tagged) - Human annexin A2 (ANXA2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Annexin A2 (ANXA2) (NM_004039) Human Untagged Clone
SC117624

USD 310.00

In Stock

ANXA2 (untagged)-Human annexin A2 (ANXA2), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Annexin A2 (ANXA2) (NM_004039) Human Tagged ORF Clone
RC204988L3

USD 620.00

3 Weeks

Lenti ORF clone of Human annexin A2 (ANXA2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Annexin A2 (ANXA2) (NM_004039) Human Tagged ORF Clone
RC204988L4

USD 620.00

3 Weeks

Lenti ORF clone of Human annexin A2 (ANXA2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Annexin A2 (ANXA2) (NM_004039) Human Tagged ORF Clone
RG204988

USD 460.00

3 Weeks

ANXA2 (GFP-tagged) - Human annexin A2 (ANXA2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Annexin A2 (ANXA2) (NM_001136015) Human Tagged ORF Clone
RG227328

USD 460.00

3 Weeks

ANXA2 (GFP-tagged) - Human annexin A2 (ANXA2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Annexin A2 (ANXA2) (NM_001002858) Human Untagged Clone
SC300465

USD 610.00

In Stock

ANXA2 (untagged)-Human annexin A2 (ANXA2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Annexin A2 (ANXA2) (NM_001002858) Human Over-expression Lysate
LY400370

USD 396.00

In Stock

Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Annexin A2 (ANXA2) Rabbit Polyclonal Antibody
TA310039

USD 230.00

2 Weeks

Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein
Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate
LY400369

USD 396.00

5 Days

Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Annexin A2 (ANXA2) (NM_001002857) Human Untagged Clone
SC300464

USD 760.00

In Stock

ANXA2 (untagged)-Human annexin A2 (ANXA2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Annexin A2 (ANXA2) Rabbit Polyclonal Antibody
TA327082

USD 380.00

3 Weeks

ANXA2 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA2
Annexin A2 (ANXA2) (NM_004039) Human Tagged ORF Clone
RC204988L2

USD 620.00

3 Weeks

Lenti ORF clone of Human annexin A2 (ANXA2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Annexin A2 (ANXA2) (NM_001002857) Human Tagged ORF Clone
RC205081L2

USD 620.00

3 Weeks

Lenti ORF clone of Human annexin A2 (ANXA2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Annexin A2 (ANXA2) Rabbit Polyclonal Antibody
TA326061

USD 345.00

In Stock

Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26.
Modifications Phospho-specific
Annexin A2 (ANXA2) Rabbit Polyclonal Antibody
AP20666PU-N

USD 407.00

2 Weeks

Annexin A2 (ANXA2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 111-160 of Human Annexin 2.
Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate
LC400369

USD 121.00

In Stock

ANXA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Annexin A2 (ANXA2) (NM_004039) Human Over-expression Lysate
LC418296

USD 121.00

In Stock

ANXA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Annexin A2 (ANXA2) (NM_004039) Human Over-expression Lysate
LC429181

USD 121.00

In Stock

ANXA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Annexin A2 / ANXA2 (1-339, His-tag) Human Protein
AR09353PU-L

USD 745.00

2 Weeks

Annexin A2 / ANXA2 (1-339, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Annexin A2 (ANXA2) Goat Polyclonal Antibody
TA302650

USD 375.00

5 Days

Goat Polyclonal Antibody against Calretinin

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1.
Annexin A2 (ANXA2) Rabbit Polyclonal Antibody
TA341656

USD 310.00

5 Days

Rabbit Polyclonal Anti-ANXA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD