Products

cDNA Clones (21)
Proteins (12)
Antibodies (4)
Jump to Filters
View as table Download
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RC210409

USD 480.00

In Stock

ASIC2 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone
RC219845

USD 530.00

In Stock

ASIC2 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone Lentiviral Particle
RC210409L1V

USD 880.00

3 Weeks

Lenti ORF particles, ASIC2 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone Lentiviral Particle
RC210409L2V

USD 880.00

6 Weeks

Lenti ORF particles, ASIC2 (mGFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone Lentiviral Particle
RC219845L1V

USD 930.00

3 Weeks

Lenti ORF particles, ASIC2 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone Lentiviral Particle
RC219845L2V

USD 930.00

6 Weeks

Lenti ORF particles, ASIC2 (mGFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ACCN1 (ASIC2) (NM_001094) Human Recombinant Protein
TP310409

USD 867.00

4 Weeks

Recombinant protein of human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RG210409

USD 530.00

In Stock

ASIC2 (GFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RC210409L3

USD 680.00

3 Weeks

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone Lentiviral Particle
RC210409L3V

USD 880.00

5 Weeks

Lenti ORF particles, ASIC2 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone Lentiviral Particle
RC210409L4V

USD 880.00

3 Weeks

Lenti ORF particles, ASIC2 (mGFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone
RC219845L3

USD 730.00

3 Weeks

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone Lentiviral Particle
RC219845L3V

USD 930.00

7 Weeks

Lenti ORF particles, ASIC2 (Myc-DDK tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone
RC219845L4

USD 730.00

3 Weeks

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone Lentiviral Particle
RC219845L4V

USD 930.00

7 Weeks

Lenti ORF particles, ASIC2 (mGFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone
RG219845

USD 580.00

3 Weeks

ASIC2 (GFP-tagged) - Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RC210409L1

USD 680.00

In Stock

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ACCN1 (ASIC2) (NM_001094) Human Untagged Clone
SC124011

USD 760.00

In Stock

ASIC2 (untagged)-Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ACCN1 (ASIC2) (NM_183377) Human Untagged Clone
SC307569

USD 960.00

In Stock

ASIC2 (untagged)-Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACCN1 (ASIC2) (Center) Rabbit Polyclonal Antibody
AP50043PU-N

USD 450.00

2 Weeks

ACCN1 (ASIC2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 127~156 amino acids from the Center region of human ACCN1
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RC210409L2

USD 680.00

3 Weeks

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Tagged ORF Clone
RC219845L2

USD 730.00

3 Weeks

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACCN1 (ASIC2) (NM_183377) Human Over-expression Lysate
LC405257

USD 187.00

In Stock

ASIC2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACCN1 (ASIC2) Rabbit Polyclonal Antibody
TA338787

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACCN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the middle region of human ACCN1. Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA
ACCN1 (ASIC2) Rabbit Polyclonal Antibody
TA329036

USD 585.00

3 Weeks

Rabbit polyclonal Anti-ASIC2a

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus.
ACCN1 (ASIC2) Rabbit Polyclonal Antibody
TA338514

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACCN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
ACCN1 (ASIC2) (NM_001094) Human Over-expression Lysate
LC400449

USD 121.00

2 Weeks

ASIC2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ACCN1 (ASIC2) (NM_001094) Human Mass Spec Standard
PH310409

USD 2,055.00

3 Weeks

ACCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001085)

Tag C-Myc/DDK
Expression Host HEK293
ACCN1 (ASIC2) (NM_001094) Human Tagged ORF Clone
RC210409L4

USD 680.00

In Stock

Lenti ORF clone of Human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACCN1 (ASIC2) ICC Control Block
TB410409

USD 1,130.00

4 Weeks

Transient overexpression of ASIC2 (NM_001094) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACCN1 (ASIC2) ICC Control Block
TB419845

USD 1,180.00

4 Weeks

Transient overexpression of ASIC2 (NM_183377) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACCN1 (ASIC2) Cytosection
TS410409

USD 225.00

4 Weeks

Transient overexpression of ASIC2 (NM_001094) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACCN1 (ASIC2) Cytosection
TS410409P5

USD 889.00

4 Weeks

Transient overexpression of ASIC2 (NM_001094) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACCN1 (ASIC2) Cytosection
TS419845

USD 225.00

4 Weeks

Transient overexpression of ASIC2 (NM_183377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACCN1 (ASIC2) Cytosection
TS419845P5

USD 889.00

4 Weeks

Transient overexpression of ASIC2 (NM_183377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack