Germany
Japan
United Kingdom
China
BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
Goat Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression lysate of BCL2-related protein A1 (BCL2A1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of BCL2-related protein A1 (BCL2A1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BCL2A1
Families
- Druggable Genome