Products

cDNA Clones (12)
Antibodies (5)
Proteins (3)
Jump to Filters
View as table Download
CBX4 (NM_003655) Human Tagged ORF Clone
RC216414

USD 520.00

In Stock

CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CBX4 (NM_003655) Human Tagged ORF Clone
RG216414

USD 570.00

In Stock

CBX4 (GFP-tagged) - Human chromobox homolog 4 (CBX4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CBX4 (NM_003655) Human Tagged ORF Clone
RC216414L3

USD 720.00

3 Weeks

Lenti-ORF clone of CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBX4 (NM_003655) Human Tagged ORF Clone
RC216414L1

USD 720.00

In Stock

Lenti-ORF clone of CBX4 (Myc-DDK-tagged)-Human chromobox homolog 4 (CBX4)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CBX4 (NM_003655) Human Untagged Clone
SC117841

USD 950.00

In Stock

CBX4 (untagged)-Human chromobox homolog 4 (CBX4)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CBX4 (NM_003655) Human Tagged ORF Clone
RC216414L2

USD 720.00

3 Weeks

Lenti-ORF clone of CBX4 (mGFP-tagged)-Human chromobox homolog 4 (CBX4)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CBX4 Rabbit Polyclonal Antibody
TA319431

USD 530.00

5 Days

Rabbit polyclonal anti-PC2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 95-107 of Human PC2 protein.
CBX4 Rabbit Polyclonal Antibody
TA319753

USD 430.00

5 Days

Rabbit Polyclonal CBX4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CBX4 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human CBX4.
CBX4 Rabbit Polyclonal Antibody
TA329637

USD 375.00

5 Days

Rabbit Polyclonal anti-CBX4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4. Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
CBX4 Rabbit Polyclonal Antibody
TA310108

USD 230.00

3 Weeks

Rabbit anti-CBX4 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
CBX4 (BC014967) Human Untagged Clone
SC312821

USD 960.00

3 Weeks

CBX4 (untagged)-Homo sapiens, clone MGC:23084 IMAGE:4856728, complete cds

Vector pCMV6 series
Tag Tag Free
CBX4 Rabbit Polyclonal Antibody
TA352002

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBX4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX4
CBX4 (NM_003655) ICC Control Block
TB416414

USD 1,170.00

4 Weeks

Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CBX4 Cytosection
TS416414

USD 225.00

4 Weeks

Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CBX4 Cytosection
TS416414P5

USD 889.00

4 Weeks

Transient overexpression of CBX4 (NM_003655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack