Products

cDNA Clones (10)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
Cyclin G2 (CCNG2) (NM_004354) Human Tagged ORF Clone
RC217068

USD 420.00

In Stock

CCNG2 (Myc-DDK-tagged)-Human cyclin G2 (CCNG2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cyclin G2 (CCNG2) (NM_004354) Human Tagged ORF Clone
RG217068

USD 460.00

In Stock

CCNG2 (GFP-tagged) - Human cyclin G2 (CCNG2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclin G2 (CCNG2) (NM_004354) Human Untagged Clone
SC117452

USD 590.00

In Stock

CCNG2 (untagged)-Human cyclin G2 (CCNG2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cyclin G2 (CCNG2) (NM_004354) Human Tagged ORF Clone
RC217068L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin G2 (CCNG2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cyclin G2 (CCNG2) (NM_004354) Human Over-expression Lysate
LC401388

USD 121.00

In Stock

CCNG2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Cyclin G2 (CCNG2) (NM_004354) Human Recombinant Protein
TP762275

USD 205.00

In Stock

Purified recombinant protein of Human cyclin G2 (CCNG2), full length, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Cyclin G2 (CCNG2) (Center) Rabbit Polyclonal Antibody
AP50814PU-N

USD 512.00

2 Weeks

Cyclin G2 (CCNG2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 214-243 amino acids from the Central region of human CCNG2
Cyclin G2 (CCNG2) Rabbit Polyclonal Antibody
TA330363

USD 310.00

5 Days

Rabbit Polyclonal Anti-CCNG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNG2 antibody: synthetic peptide directed towards the N terminal of human CCNG2. Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
Cyclin G2 (CCNG2) ICC Control Block
TB417068

USD 1,070.00

4 Weeks

Transient overexpression of CCNG2 (NM_004354) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cyclin G2 (CCNG2) Cytosection
TS417068

USD 225.00

4 Weeks

Transient overexpression of CCNG2 (NM_004354) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cyclin G2 (CCNG2) Cytosection
TS417068P5

USD 889.00

4 Weeks

Transient overexpression of CCNG2 (NM_004354) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack