CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC25B (Myc-DDK tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC25B (mGFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (Myc-DDK tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (mGFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC25B (mGFP-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 10
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (myc-DDK-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (untagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-Cdc25b Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
Lenti ORF clone of Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P). |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323 |
Modifications | Phospho-specific |
CDC25B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal CDC25B (Ser353) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 353 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI11C5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CDC25B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 10
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC25B (GFP-tagged) - Human cell division cycle 25B (CDC25B), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |