Products

Antibodies (11)
cDNA Clones (11)
Proteins (7)
Jump to Filters
View as table Download
p60 CAF1 (CHAF1B) (NM_005441) Human Recombinant Protein
TP302858

USD 823.00

In Stock

Recombinant protein of human chromatin assembly factor 1, subunit B (p60) (CHAF1B)

Tag C-Myc/DDK
Expression Host HEK293T
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone
RC202858

USD 420.00

In Stock

CHAF1B (Myc-DDK-tagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone
RC202858L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone Lentiviral Particle
RC202858L3V

USD 820.00

6 Weeks

Lenti ORF particles, CHAF1B (Myc-DDK tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone
RC202858L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone
RG202858

USD 460.00

3 Weeks

CHAF1B (GFP-tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
p60 CAF1 (CHAF1B) (NM_005441) Human Untagged Clone
SC111066

USD 310.00

In Stock

CHAF1B (untagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone
RC202858L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: SS 24 1-68]
TA336654

USD 363.00

5 Days

Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
p60 CAF1 (CHAF1B) (NM_005441) Human Over-expression Lysate
LC401669

USD 121.00

In Stock

CHAF1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA312229

USD 345.00

4 Weeks

Rabbit polyclonal anti-CAF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAF1B.
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA338926

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the C terminal of human CHAF1B. Synthetic peptide located within the following region: PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: SS 53]
TA301488

USD 424.00

5 Days

Mouse Monoclonal Antibody against CAF-1 p60 (SS 53)

Applications WB
Reactivities Human
Conjugation Unconjugated
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA338925

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: OTI4F7]
CF506840

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: OTI2D5]
CF506841

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHAF1B mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
p60 CAF1 (CHAF1B) (NM_005441) Human Mass Spec Standard
PH302858

USD 2,055.00

3 Weeks

CHAF1B MS Standard C13 and N15-labeled recombinant protein (NP_005432)

Tag C-Myc/DDK
Expression Host HEK293
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: OTI4F7]
TA506840

USD 379.00

In Stock

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody [Clone ID: OTI4F7]
TA506840S

USD 159.00

2 Days

CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
p60 CAF1 (CHAF1B) (NM_005441) ICC Control Block
TB402858

USD 1,070.00

4 Weeks

Transient overexpression of CHAF1B (NM_005441) in HEK293T cells paraffin embedded controls for ICC/IHC staining

p60 CAF1 (CHAF1B) Cytosection
TS402858

USD 225.00

4 Weeks

Transient overexpression of CHAF1B (NM_005441) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

p60 CAF1 (CHAF1B) Cytosection
TS402858P5

USD 889.00

4 Weeks

Transient overexpression of CHAF1B (NM_005441) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack