Germany
Japan
United Kingdom
China
Recombinant protein of human chromatin assembly factor 1, subunit B (p60) (CHAF1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
CHAF1B (Myc-DDK-tagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
4 Weeks
Lenti ORF particles, CHAF1B (Myc-DDK tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CHAF1B (mGFP-tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Chaf1b (Myc-DDK-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CHAF1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402858 is the updated version of KN202858.
Chaf1b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503233 is the updated version of KN303233.
Chaf1b (GFP-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Chaf1b (Myc-DDK-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chaf1b (Myc-DDK-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chaf1b (mGFP-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chaf1b (GFP-tagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CHAF1B (Myc-DDK tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CHAF1B (mGFP-tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CHAF1B (GFP-tagged) - Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Chaf1b (Myc-DDK-tagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Chaf1b (Myc-DDK-tagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chaf1b (Myc-DDK-tagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Chaf1b (mGFP-tagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Chaf1b (GFP-tagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CHAF1B (untagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Chaf1b (untagged) - Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chromatin assembly factor 1, subunit B (p60) (CHAF1B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Mouse Monoclonal CHAF1B Antibody (SS 24 1-68)
| Applications | WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
CHAF1B - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Chaf1b - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
CHAF1B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CHAF1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of chromatin assembly factor 1, subunit B (p60) (CHAF1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CHAF1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the C terminal of human CHAF1B. Synthetic peptide located within the following region: PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP |
Mouse Monoclonal Antibody against CAF-1 p60 (SS 53)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CHAF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD |
CHAF1B CRISPRa kit - CRISPR gene activation of human chromatin assembly factor 1 subunit B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CHAF1B
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CHAF1B
qPCR primer pairs and template standards against Mus musculus gene Chaf1b
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Chaf1b
CHAF1B MS Standard C13 and N15-labeled recombinant protein (NP_005432)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Chaf1b (untagged ORF) - Rat chromatin assembly factor 1, subunit B (p60) (Chaf1b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of chromatin assembly factor 1 subunit B (p60) (CHAF1B) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Chaf1b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Chaf1b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
p60 CAF1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 270-559 of human p60 CAF1 (NP_005432.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHAF1B