CHRND (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, delta (CHRND)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CHRND (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, delta (CHRND)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CHRND (GFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CHRND (Myc-DDK tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CHRND (GFP-tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CHRND (untagged)-Human cholinergic receptor, nicotinic, delta (CHRND)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
CHRND (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human CHRND |
Transient overexpression lysate of cholinergic receptor, nicotinic, delta (CHRND)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN |
CHRND HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CHRND (untagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack