Products

cDNA Clones (14)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
CHRND (NM_000751) Human Tagged ORF Clone
RC210881

USD 470.00

In Stock

CHRND (Myc-DDK-tagged)-Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CHRND (NM_000751) Human Tagged ORF Clone Lentiviral Particle
RC210881L1V

USD 870.00

3 Weeks

Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CHRND (NM_000751) Human Tagged ORF Clone Lentiviral Particle
RC210881L2V

USD 870.00

6 Weeks

Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CHRND (NM_000751) Human Tagged ORF Clone
RG210881

USD 520.00

In Stock

CHRND (GFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CHRND (NM_000751) Human Tagged ORF Clone
RC210881L3

USD 670.00

3 Weeks

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CHRND (NM_000751) Human Tagged ORF Clone Lentiviral Particle
RC210881L3V

USD 870.00

5 Weeks

Lenti ORF particles, CHRND (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CHRND (NM_000751) Human Tagged ORF Clone
RC210881L4

USD 670.00

3 Weeks

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CHRND (NM_000751) Human Tagged ORF Clone Lentiviral Particle
RC210881L4V

USD 870.00

7 Weeks

Lenti ORF particles, CHRND (mGFP-tagged) - Human cholinergic receptor, nicotinic, delta (CHRND), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CHRND (NM_001256657) Human Tagged ORF Clone
RC234302

USD 480.00

5 Weeks

CHRND (Myc-DDK tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CHRND (NM_001256657) Human Tagged ORF Clone
RG234302

USD 530.00

5 Weeks

CHRND (GFP-tagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CHRND (NM_000751) Human Tagged ORF Clone
RC210881L1

USD 828.00

In Stock

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CHRND (NM_000751) Human Untagged Clone
SC119700

USD 880.00

In Stock

CHRND (untagged)-Human cholinergic receptor, nicotinic, delta (CHRND)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CHRND (NM_000751) Human Tagged ORF Clone
RC210881L2

USD 670.00

3 Weeks

Lenti ORF clone of Human cholinergic receptor, nicotinic, delta (CHRND), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CHRND Rabbit Polyclonal Antibody
TA330429

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
CHRND (Center) Rabbit Polyclonal Antibody
AP50909PU-N

USD 450.00

2 Weeks

CHRND (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human CHRND
CHRND (NM_000751) Human Over-expression Lysate
LY424535

USD 396.00

5 Days

Transient overexpression lysate of cholinergic receptor, nicotinic, delta (CHRND)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CHRND Rabbit Polyclonal Antibody
TA330430

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
CHRND Rabbit Polyclonal Antibody
TA338498

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN
CHRND (NM_000751) Human Over-expression Lysate
LC424535

USD 121.00

2 Weeks

CHRND HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CHRND (NM_001256657) Human Untagged Clone
SC332438

USD 500.00

5 Weeks

CHRND (untagged) - Homo sapiens cholinergic receptor, nicotinic, delta (muscle) (CHRND), transcript variant 2

Vector pCMV6 series
Tag Tag Free
CHRND ICC Control Block
TB410881

USD 1,120.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CHRND ICC Control Block
TB434302

USD 1,130.00

4 Weeks

Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CHRND Cytosection
TS410881

USD 225.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CHRND Cytosection
TS410881P5

USD 889.00

4 Weeks

Transient overexpression of CHRND (NM_000751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CHRND ICC Control Sections
TS434302P5

USD 889.00

4 Weeks

Transient overexpression of CHRND (NM_001256657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack