Products

cDNA Clones (9)
Proteins (8)
Antibodies (6)
Jump to Filters
View as table Download
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone
RC201992

USD 420.00

In Stock

CXCL1 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone Lentiviral Particle
RC201992L1V

USD 820.00

3 Weeks

Lenti ORF particles, CXCL1 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone Lentiviral Particle
RC201992L2V

USD 820.00

6 Weeks

Lenti ORF particles, CXCL1 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone
RG201992

USD 460.00

In Stock

CXCL1 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone Lentiviral Particle
RC201992L4V

USD 820.00

In Stock

Lenti ORF particles, CXCL1 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone Lentiviral Particle
RC201992L3V

USD 820.00

3 Weeks

Lenti ORF particles, CXCL1 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRO alpha (CXCL1) (NM_001511) Human Untagged Clone
SC119178

USD 540.00

In Stock

CXCL1 (untagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GRO alpha (CXCL1) (NM_001511) Human Untagged Clone
SC322326

USD 310.00

In Stock

CXCL1 (untagged)-Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA319046

USD 435.00

In Stock

Rabbit polyclonal anti-CXCL1 (KC) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 78 of mouse KC
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA348009

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GRO alpha

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha
GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein
TP723148

USD 240.00

5 Days

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1).

Tag Tag Free
Expression Host E. coli
GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein
TP723735

USD 170.00

5 Days

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1 / GRO-alpha)

Tag Tag Free
Expression Host E. coli
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA328330

USD 285.00

5 Days

Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA332925

USD 275.00

3 Weeks

Rabbit anti-CXCL1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CXCL1
GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein
TP760977

USD 215.00

In Stock

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
GRO alpha (CXCL1) (NM_001511) Human Tagged ORF Clone
RC201992L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA328329

USD 285.00

5 Days

Biotinylated Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA330384

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXCL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL1 antibody: synthetic peptide directed towards the middle region of human CXCL1. Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
CXCL1 / GRO-alpha (35-107, His-tag) Human Protein
AR50026PU-N

USD 620.00

2 Weeks

CXCL1 / GRO-alpha (35-107, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CXCL1 / GRO-alpha (35-107, His-tag) Human Protein
AR50026PU-S

USD 260.00

2 Weeks

CXCL1 / GRO-alpha (35-107, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
GRO alpha (CXCL1) ICC Control Block
TB401992

USD 1,070.00

4 Weeks

Transient overexpression of CXCL1 (NM_001511) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRO alpha (CXCL1) Cytosection
TS401992

USD 225.00

4 Weeks

Transient overexpression of CXCL1 (NM_001511) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRO alpha (CXCL1) Cytosection
TS401992P5

USD 889.00

4 Weeks

Transient overexpression of CXCL1 (NM_001511) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack