Products

cDNA Clones (14)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
DLL3 (NM_016941) Human Tagged ORF Clone
RC200005

USD 570.00

In Stock

DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DLL3 (NM_016941) Human Untagged Clone
SC111951

USD 310.00

In Stock

DLL3 (untagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DLL3 (NM_016941) Human Tagged ORF Clone
RG200005

USD 630.00

In Stock

DLL3 (GFP-tagged) - Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DLL3 (NM_016941) Human Tagged ORF Clone Lentiviral Particle
RC200005L1V

USD 1,200.00

3 Weeks

Lenti ORF particles, DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DLL3 (NM_203486) Human Tagged ORF Clone
RG222403

USD 680.00

In Stock

DLL3 (GFP-tagged) - Human delta-like 3 (Drosophila) (DLL3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DLL3 (NM_016941) Human Tagged ORF Clone
RC200005L3

USD 948.00

3 Weeks

Lenti-ORF clone of DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DLL3 (NM_203486) Human Tagged ORF Clone
RC222403

USD 620.00

2 Weeks

DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DLL3 (NM_016941) Human Tagged Lenti ORF Clone
RC200005L4

USD 948.00

In Stock

Lenti-ORF clone of DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DLL3 (NM_016941) Human Over-expression Lysate
LY413792

USD 396.00

In Stock

Transient overexpression lysate of delta-like 3 (Drosophila) (DLL3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DLL3 (NM_016941) Human Tagged ORF Clone Lentiviral Particle
RC200005L2V

USD 1,200.00

3 Weeks

Lenti ORF particles, DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DLL3 (NM_016941) Human Tagged ORF Clone Lentiviral Particle
RC200005L3V

USD 1,200.00

3 Weeks

Lenti ORF particles, DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DLL3 (NM_016941) Human Tagged ORF Clone
RC200005L1

USD 948.00

In Stock

Lenti-ORF clone of DLL3 (Myc-DDK-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DLL3 (NM_016941) Human Tagged ORF Clone Lentiviral Particle
RC200005L4V

USD 1,200.00

3 Weeks

Lenti ORF particles, DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DLL3 (C-term) Rabbit Polyclonal Antibody
AP51274PU-N

USD 450.00

2 Weeks

DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3.
DLL3 Rabbit Polyclonal Antibody
TA337030

USD 424.00

5 Days

Rabbit Polyclonal DLL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody.
DLL3 (NM_016941) Human Tagged ORF Clone
RC200005L2

USD 948.00

In Stock

Lenti-ORF clone of DLL3 (mGFP-tagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DLL3 (NM_203486) Human Untagged Clone
SC308208

USD 1,000.00

In Stock

DLL3 (untagged)-Human delta-like 3 (Drosophila) (DLL3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DLL3 Rabbit Polyclonal Antibody
TA342025

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL
DLL3 (NM_016941) Human Over-expression Lysate
LC413792

USD 121.00

In Stock

DLL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DLL3 Rabbit Polyclonal Antibody
TA342026

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
DLL3 CytoSection
TS400005P5

USD 978.00

In Stock

Transient overexpression of DLL3 (NM_016941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DLL3 (NM_203486) ICC Control Block
TB422403

USD 1,270.00

4 Weeks

Transient overexpression of DLL3 (NM_203486) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DLL3 Cytosection
TS400005

USD 225.00

4 Weeks

Transient overexpression of DLL3 (NM_016941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DLL3 ICC Control Sections
TS422403P5

USD 889.00

4 Weeks

Transient overexpression of DLL3 (NM_203486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack